[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54209.1
DDBJ      :             probable conserved membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->84 PF02656 * DUF202 2.4e-17 43.5 62/70  
:BLT:SWISS 11->38 Y2295_MYCBO 1e-07 75.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54209.1 GT:GENE AAZ54209.1 GT:PRODUCT probable conserved membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(196277..196651) GB:FROM 196277 GB:TO 196651 GB:DIRECTION - GB:PRODUCT probable conserved membrane protein GB:PROTEIN_ID AAZ54209.1 GB:DB_XREF GI:71914307 LENGTH 124 SQ:AASEQ MGALSRAKRRANDGGDGKEPDYRFTLANERTFLAWIRTALALVAGAVAVLHLVPLRWHGGTQLSVGLALAALAVVITCYAPIRWMRVQRAMRHDQPLPTTPLPLITALGIGLICLAVVVGNYLP GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 11->38|Y2295_MYCBO|1e-07|75.0|28/122| TM:NTM 3 TM:REGION 34->56| TM:REGION 62->84| TM:REGION 99->121| SEG 39->55|alalvagavavlhlvpl| SEG 63->75|lsvglalaalavv| SEG 96->108|plpttplplital| HM:PFM:NREP 1 HM:PFM:REP 23->84|PF02656|2.4e-17|43.5|62/70|DUF202| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-22| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccc //