[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54226.1
DDBJ      :             2-keto-3-deoxy-phosphogluconate aldolase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:210 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->164 1vlwC PDBj 8e-14 27.0 %
:RPS:SCOP  6->164 1euaA  c.1.10.1 * 7e-13 19.1 %
:HMM:SCOP  1->199 1vlwA_ c.1.10.1 * 1.6e-47 44.9 %
:RPS:PFM   93->164 PF01081 * Aldolase 9e-13 48.6 %
:HMM:PFM   10->186 PF01081 * Aldolase 9.2e-39 36.6 175/196  
:BLT:SWISS 108->160 ALKH_BACSU 5e-11 49.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54226.1 GT:GENE AAZ54226.1 GT:PRODUCT 2-keto-3-deoxy-phosphogluconate aldolase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(210803..211435) GB:FROM 210803 GB:TO 211435 GB:DIRECTION - GB:PRODUCT 2-keto-3-deoxy-phosphogluconate aldolase GB:PROTEIN_ID AAZ54226.1 GB:DB_XREF GI:71914324 LENGTH 210 SQ:AASEQ MDFADLFAGQQVMAILRGLSAQDTVAHAHRAWDLGIALVEVPIQSPDALPALRAAVAAGRSRGRPVGAGTVTTPDRVAAAADAGAAFTVAPGFDGEVLAASLAAGLPHLPGVATPSEIQQALRHGATWLKAFPATVLGTGWFAAMRGPFPEVNLVATGGVSAHNAADYLAAGARAVAVGSALADETQWEALAALAASSTGPWGSGSGPAA GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 108->160|ALKH_BACSU|5e-11|49.1|53/196| SEG 48->92|alpalraavaagrsrgrpvgagtvttpdrvaaaadagaaftvapg| SEG 165->184|aadylaagaravavgsalad| SEG 195->209|aasstgpwgsgsgpa| BL:PDB:NREP 1 BL:PDB:REP 1->164|1vlwC|8e-14|27.0|163/204| RP:PFM:NREP 1 RP:PFM:REP 93->164|PF01081|9e-13|48.6|72/194|Aldolase| HM:PFM:NREP 1 HM:PFM:REP 10->186|PF01081|9.2e-39|36.6|175/196|Aldolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01081|IPR000887| GO:PFM GO:0008152|"GO:metabolic process"|PF01081|IPR000887| RP:SCP:NREP 1 RP:SCP:REP 6->164|1euaA|7e-13|19.1|157/213|c.1.10.1| HM:SCP:REP 1->199|1vlwA_|1.6e-47|44.9|198/0|c.1.10.1|1/1|Aldolase| OP:NHOMO 64 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- --------------------------------------11-----1------1-1--1--------1---1-----------1------------------------1--------------------------------------------------------1------------------1-------1----------------------1----11-1---------1--------------------1---22---------12------111----------------1------------------22---2222--------------------------1-----------------1-----------------1----------------------------------------------------------11----------------------------------------------------------------------------------------------------------------1111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1111-----------------------1------------------------------------------------------------------------------111-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 77.6 SQ:SECSTR HHHHHHHHHHcEEEEEccccHHHHHHHHHHHHHTTccEEEEETTcTTHHHHHHHTHHHHHTTcEEEEEccccHHHHHHHHHTTccEEEccc#ccHHHHHHHHHHTcEEEcEEccHHHHHHHHHTTccEEEETTTTTccHHHHHHHHTTcTTcEEEEcccccTTT############################################## DISOP:02AL 206-210| PSIPRED ccHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHcccEEEcccccHHHHHHHHHcccEEEcccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHcccccEEEEccccHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHHHHHHcccccc //