[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54232.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   11->71 3cr7D PDBj 8e-04 16.4 %
:HMM:PFM   14->41 PF07959 * Fucokinase 0.00094 42.9 28/413  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54232.1 GT:GENE AAZ54232.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 218298..218522 GB:FROM 218298 GB:TO 218522 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54232.1 GB:DB_XREF GI:71914330 LENGTH 74 SQ:AASEQ MDIDPHVPLHDAVALAEIDLYTDVLAAVGEADAPLTTDELDRVLGLRPRTAQSASPMRLVLDEPVSQETPELSC GT:EXON 1|1-74:0| RP:PDB:NREP 1 RP:PDB:REP 11->71|3cr7D|8e-04|16.4|61/183| HM:PFM:NREP 1 HM:PFM:REP 14->41|PF07959|0.00094|42.9|28/413|Fucokinase| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 61 STR:RPRED 82.4 SQ:SECSTR ##########ccccccEEEEEEEccHHHHHHHcTTcHHHHHHHTccccccTTccccccccEEEEcccccHH### DISOP:02AL 1-3, 68-70, 73-74| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccccccEEEEEccccccccccccc //