[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54240.1
DDBJ      :             conserved hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:187 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   102->141 PF03704 * BTAD 2.7e-05 32.5 40/146  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54240.1 GT:GENE AAZ54240.1 GT:PRODUCT conserved hypothetical conserved protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(229336..229899) GB:FROM 229336 GB:TO 229899 GB:DIRECTION - GB:PRODUCT conserved hypothetical conserved protein GB:PROTEIN_ID AAZ54240.1 GB:DB_XREF GI:71914338 LENGTH 187 SQ:AASEQ MNDARVVETLGGCRVDGVPVRHGRALELVAVLALAKGSAPRDWLLSTLFEGDPAPSSLPTLALRARKLGIDVRYDRDRCCYLLAGEVRCDVVEVLELVEEGRLAEAVARYRGPFLPKSYSPFAVQMRASLEERLVRAALLSDDVALMASVDRVVKHPELSQELVRRGGDAVVVSLSRSWLAGLEAAI GT:EXON 1|1-187:0| SEG 25->35|alelvavlala| SEG 86->109|evrcdvvevlelveegrlaeavar| HM:PFM:NREP 1 HM:PFM:REP 102->141|PF03704|2.7e-05|32.5|40/146|BTAD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccHHHHHHHcccEEccEEcccHHHHHHHHHHHccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccHHcccccHHHHHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccEEEEEHHHHHHHHHHHcc //