[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54253.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->56 PF04149 * DUF397 9e-11 61.2 %
:HMM:PFM   7->57 PF04149 * DUF397 7.5e-21 52.9 51/56  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54253.1 GT:GENE AAZ54253.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(244532..244714) GB:FROM 244532 GB:TO 244714 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54253.1 GB:DB_XREF GI:71914351 LENGTH 60 SQ:AASEQ MHSFHIEWRKSSFSQNENCVEVADLPGATAVRDTQHRDLMLLFPSAEWVAFVKAAKRDLL GT:EXON 1|1-60:0| RP:PFM:NREP 1 RP:PFM:REP 8->56|PF04149|9e-11|61.2|49/55|DUF397| HM:PFM:NREP 1 HM:PFM:REP 7->57|PF04149|7.5e-21|52.9|51/56|DUF397| OP:NHOMO 6 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------6---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 60-61| PSIPRED ccEEEEEEEEEEEcccccEEEEEEcccccEEEccccccEEEEEcHHHHHHHHHHHHHHcc //