[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54262.1
DDBJ      :             trehalose-phosphatase:HAD-superfamily hydrolase subfamily IIB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:291 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  44->216 1u02A  c.108.1.15 * 1e-19 21.7 %
:HMM:SCOP  44->286 1u02A_ c.108.1.15 * 9.4e-35 33.9 %
:RPS:PFM   49->221 PF02358 * Trehalose_PPase 2e-06 27.5 %
:HMM:PFM   48->250 PF02358 * Trehalose_PPase 3.2e-34 31.0 200/235  
:BLT:SWISS 48->220 OTSB_MYCLE 2e-08 31.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54262.1 GT:GENE AAZ54262.1 GT:PRODUCT trehalose-phosphatase:HAD-superfamily hydrolase subfamily IIB GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 252001..252876 GB:FROM 252001 GB:TO 252876 GB:DIRECTION + GB:PRODUCT trehalose-phosphatase:HAD-superfamily hydrolase subfamily IIB GB:PROTEIN_ID AAZ54262.1 GB:DB_XREF GI:71914360 InterPro:IPR003337 InterPro:IPR006379 LENGTH 291 SQ:AASEQ MRAVSGIPPAFSPPSGKPSMSLLQSTTQSGKVALDRIRDMPDRAVCAFDFDGTLAPIVPDPRDSRAHPGAVPALRALAGRVRAVAVITGRPAQTAVDYGGLDAVPGITVLGHYGRERWEDGKLTVPEPPPGVAMVREALPGLLDEVGAPEGTWIEDKKHALAVHTRRTADPEAALELLRAPLADLAKRAELAVEPGRMVIELRPPGVDKGAALTDLVTRLGAEAVLYAGDDLGDLAAYDAVERLREQGVAGFKLCSGSAEVTELARRADAVVPGPEGVVAFLEELVAAVGG GT:EXON 1|1-291:0| BL:SWS:NREP 1 BL:SWS:REP 48->220|OTSB_MYCLE|2e-08|31.7|167/429| SEG 68->86|pgavpalralagrvravav| SEG 169->186|adpeaalellrapladla| SEG 224->241|avlyagddlgdlaaydav| SEG 276->290|egvvafleelvaavg| RP:PFM:NREP 1 RP:PFM:REP 49->221|PF02358|2e-06|27.5|171/222|Trehalose_PPase| HM:PFM:NREP 1 HM:PFM:REP 48->250|PF02358|3.2e-34|31.0|200/235|Trehalose_PPase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02358|IPR003337| GO:PFM GO:0005992|"GO:trehalose biosynthetic process"|PF02358|IPR003337| RP:SCP:NREP 1 RP:SCP:REP 44->216|1u02A|1e-19|21.7|166/229|c.108.1.15| HM:SCP:REP 44->286|1u02A_|9.4e-35|33.9|221/229|c.108.1.15|1/1|HAD-like| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -------------------------------------1--1111---1--------------11---1111--------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-23, 290-291| PSIPRED ccccccccccccccccccccccccccHHccHHHHHHHHHHHccEEEEEEccHHHcccccccccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHccccccccEEEEccEEEEEEcccEEcccccHHHHHHHHHHHHHHHHHHHccccEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEccEEEEEEcccccHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHccccccEEEEEccccccccccccEEEEccHHHHHHHHHHHHHHHcc //