[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54267.1
DDBJ      :             putative MutT family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->121 3hhjB PDBj 8e-08 38.1 %
:RPS:PDB   11->138 2b06A PDBj 1e-14 20.3 %
:RPS:SCOP  11->138 2b06A1  d.113.1.1 * 7e-15 20.3 %
:HMM:SCOP  10->121 1vcdA1 d.113.1.1 * 7.6e-21 32.1 %
:RPS:PFM   22->70 PF00293 * NUDIX 1e-06 46.9 %
:HMM:PFM   25->123 PF00293 * NUDIX 2e-16 31.2 96/135  
:BLT:SWISS 11->64 NUDT6_MOUSE 2e-06 44.4 %
:BLT:SWISS 38->85 MUTT_PROVU 6e-06 44.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54267.1 GT:GENE AAZ54267.1 GT:PRODUCT putative MutT family protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(258636..259061) GB:FROM 258636 GB:TO 259061 GB:DIRECTION - GB:PRODUCT putative MutT family protein GB:PROTEIN_ID AAZ54267.1 GB:DB_XREF GI:71914365 InterPro:IPR000086 LENGTH 141 SQ:AASEQ MGAVDSATPAVVDALAWVHVRDGRVLQVRPKGKDVFYFPGGKREPGENDAEALIREVAEEVSVQLDPATLQLFTVVDAAAHGYPEGTRVRLTCYTAECTGDLAPRSEIAELAWFTQADADRCAPAGVRVLAELAQRGLVTR GT:EXON 1|1-141:0| BL:SWS:NREP 2 BL:SWS:REP 11->64|NUDT6_MOUSE|2e-06|44.4|54/313| BL:SWS:REP 38->85|MUTT_PROVU|6e-06|44.2|43/112| BL:PDB:NREP 1 BL:PDB:REP 21->121|3hhjB|8e-08|38.1|97/131| RP:PDB:NREP 1 RP:PDB:REP 11->138|2b06A|1e-14|20.3|123/150| RP:PFM:NREP 1 RP:PFM:REP 22->70|PF00293|1e-06|46.9|49/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 25->123|PF00293|2e-16|31.2|96/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 11->138|2b06A1|7e-15|20.3|123/150|d.113.1.1| HM:SCP:REP 10->121|1vcdA1|7.6e-21|32.1|106/0|d.113.1.1|1/1|Nudix| OP:NHOMO 58 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- -----1-----2-11---------------------2111------11-111-111----1----11--11--------------------------------1-2----------------------------------------------------------------------------------------------------------------------------------------------1---1---------------------------------------------------------------------------------------------------------------------------111--------1----1----------------------------------------1------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------1-----------------------------------------------------------1------------------1--------------------------------------1---------------------------------------------11-11111-1--1-----1-1--11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 99.3 SQ:SECSTR TTEEEcccccEEEEEEEEEETTTTEEEEEEEcccEEEcccccccTTccHHHHHHHHHHHHHcEEEEcEEcEEEEEEEEEEEEcTTccEEEEEEEEEcEEEEcccccTTcEEEEEEGGGGGGccTTHHHHHHHHHcTTccc# DISOP:02AL 1-6| PSIPRED cccccccccEEEEEEEEEEEEccEEEEEEEccccEEEccccEEcccccHHHHHHHHHHHHcccEEEEccEEEEEEEEcccccccccEEEEEEEEEEEEcccccccccHHEEEEccHHHHHHcccccHHHHHHHHHHHcccc //