Thermobifida fusca YX (tfus0)
Gene : AAZ54271.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54271.1 GT:GENE AAZ54271.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(260468..260734) GB:FROM 260468 GB:TO 260734 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54271.1 GB:DB_XREF GI:71914369 LENGTH 88 SQ:AASEQ MPLRYPVTDPQRSLQPFRAAMPLRPAPARGEPLRSPGDNPHRGHDRSRTVLPRAGGARHPPAPSAARAAPRSPRQATGLFGTPPQILM GT:EXON 1|1-88:0| SEG 16->29|pfraamplrpapar| SEG 52->74|praggarhppapsaaraaprspr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 26-47, 58-75| PSIPRED ccccccccccHHHHHHHHHcccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccc //