[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54293.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   141->160 PF12232 * Myf5 0.00092 36.8 19/73  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54293.1 GT:GENE AAZ54293.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(285922..286440) GB:FROM 285922 GB:TO 286440 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54293.1 GB:DB_XREF GI:71914391 LENGTH 172 SQ:AASEQ MRLAFCRRPGCRPRHARPPWIVRATRARWLVASFAVLSLGGAAGLLSPHAEDSIAQSTPDAEIQPAAVASYFAPQHTTPPVPVVRTTPPQTLTRAADLQPVTLPRPSEPTPTPPAETDDRSNDRREIAELSGPDHWSPRSEAPHRYSPSSSPEATCSDSVFMLWEGCGEEDF GT:EXON 1|1-172:0| TM:NTM 1 TM:REGION 28->50| SEG 32->47|asfavlslggaaglls| SEG 74->94|pqhttppvpvvrttppqtltr| SEG 102->117|tlprpseptptppaet| HM:PFM:NREP 1 HM:PFM:REP 141->160|PF12232|0.00092|36.8|19/73|Myf5| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 106-127, 137-154, 170-172| PSIPRED cccccccccccccccccccEEEEEccHHHHHHHHHHHHHcccccccccccccHHHHcccccccccHHHHHHHccccccccccEEEccccHHHHHHcccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccEEEEEEccccccc //