[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54303.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->80 1a6qA PDBj 2e-04 10.0 %
:HMM:SCOP  32->159 1l0oA_ d.122.1.3 * 3.7e-09 15.9 %
:HMM:PFM   63->138 PF02518 * HATPase_c 4.9e-07 26.0 73/111  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54303.1 GT:GENE AAZ54303.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 295713..296204 GB:FROM 295713 GB:TO 296204 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54303.1 GB:DB_XREF GI:71914401 LENGTH 163 SQ:AASEQ MQYLLFCPINPDRFSRTVRSGGGPVTISLTSFPGIPDSVAAARRFVTGMLRLCPQTSAPDEVVHRVELIVSELCTNAIRHTRSGDPGQKFHVHVCTDERGVHVEVRTLPPRRPRSVPRVVPPEDPFSEHGRGMFLVDQWATQWGTLSPRENGVYFLLAWEPSD GT:EXON 1|1-163:0| SEG 105->122|vrtlpprrprsvprvvpp| RP:PDB:NREP 1 RP:PDB:REP 7->80|1a6qA|2e-04|10.0|70/363| HM:PFM:NREP 1 HM:PFM:REP 63->138|PF02518|4.9e-07|26.0|73/111|HATPase_c| HM:SCP:REP 32->159|1l0oA_|3.7e-09|15.9|126/141|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 5 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------5---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 70 STR:RPRED 42.9 SQ:SECSTR ######ccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHH####HHHTTcccccTTTGGGGGHHHHHHHHHHHccc################################################################################### DISOP:02AL 162-163| PSIPRED ccEEEEccccccHHHHcccccccccEEEEEEccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEccEEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEEEcccc //