[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54312.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:276 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   136->173 PF12292 * DUF3624 0.00067 28.9 38/77  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54312.1 GT:GENE AAZ54312.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(305720..306550) GB:FROM 305720 GB:TO 306550 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54312.1 GB:DB_XREF GI:71914410 LENGTH 276 SQ:AASEQ MSEWFAVHIVATGRLPLFSFFVAFVAGFLMIRCSVRMIRARVRWWPGNLTPFGLHIHHVVFGVAFMLIGGVAGLLITDRDGAAMATAAALFGFGAALVLDEFALILHLRDVYWTEQGRTSVDAVFVAIALSGLLLTGLRPVGWGLWGITVDTTITQIGMVALILINFAGAAVSLLKGKIWSGIIGIFIPVISIITAIRLAVPGSPWARWRYPEGSAKLAAAIRRDQRLRRPFIRAKIWFQELIAGRHDLILEPSPAFHQQLPTVSERSTPPVRHVD GT:EXON 1|1-276:0| TM:NTM 6 TM:REGION 9->31| TM:REGION 55->77| TM:REGION 86->108| TM:REGION 118->140| TM:REGION 154->176| TM:REGION 182->203| SEG 81->97|gaamataaalfgfgaal| SEG 179->194|iwsgiigifipvisii| HM:PFM:NREP 1 HM:PFM:REP 136->173|PF12292|0.00067|28.9|38/77|DUF3624| OP:NHOMO 31 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- -1--1---------11111-11--1111111-11111222---1--------------------1----11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 217-222, 260-276| PSIPRED ccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEccEEEEEEEccEEEEEEEcEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccHHHHHHHHHHHHHHHHccccccHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHcccHHHHHHcccccccccccccccc //