[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54321.1
DDBJ      :             polyamine ABC-transporter, inner membrane subunit
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  602/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.52.1f.58.1
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   106->219 3d31C PDBj 1e-10 27.2 %
:RPS:PDB   24->174 3dmdC PDBj 2e-04 9.6 %
:RPS:PDB   171->210 3dhwA PDBj 1e-10 22.5 %
:RPS:SCOP  40->84 1sdoA  c.52.1.21 * 2e-04 11.1 %
:RPS:SCOP  58->262 2r6gG1  f.58.1.1 * 5e-18 18.0 %
:RPS:PFM   141->227 PF00528 * BPD_transp_1 1e-09 37.9 %
:HMM:PFM   97->265 PF00528 * BPD_transp_1 1.3e-19 26.8 164/185  
:BLT:SWISS 46->274 POTC_SHIFL 1e-39 34.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54321.1 GT:GENE AAZ54321.1 GT:PRODUCT polyamine ABC-transporter, inner membrane subunit GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 316205..317029 GB:FROM 316205 GB:TO 317029 GB:DIRECTION + GB:PRODUCT polyamine ABC-transporter, inner membrane subunit GB:PROTEIN_ID AAZ54321.1 GB:DB_XREF GI:71914419 LENGTH 274 SQ:AASEQ MSATATKAEATVSRRQRRPRITLGKVFTWAVLVWLFLPIAGMIAFSFNDISGRHNVTWQGFTLKWYGKAFVYPDLNQALFNTLLIGFATMLIAGITGTLLGLAMGRYRFRGQQASNLVMFAAISAPEVVIGASLLSLFIALNLTLGMTTVIIAHVMFSISFVAITVRARVMTMDPSIEEAARDLGADSWTTFRLVTFPMLFPAIMAGGLLAFALSVDDFIITSFVSGDLTTFPLWIWGSTRVGIPPQVNVMGTLIFVVGVLLAITNIILARRRS GT:EXON 1|1-274:0| BL:SWS:NREP 1 BL:SWS:REP 46->274|POTC_SHIFL|1e-39|34.8|227/264| TM:NTM 6 TM:REGION 25->47| TM:REGION 82->104| TM:REGION 117->139| TM:REGION 146->167| TM:REGION 213->235| TM:REGION 249->270| SEG 90->105|mliagitgtllglamg| BL:PDB:NREP 1 BL:PDB:REP 106->219|3d31C|1e-10|27.2|114/248| RP:PDB:NREP 2 RP:PDB:REP 24->174|3dmdC|2e-04|9.6|146/318| RP:PDB:REP 171->210|3dhwA|1e-10|22.5|40/203| RP:PFM:NREP 1 RP:PFM:REP 141->227|PF00528|1e-09|37.9|87/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 97->265|PF00528|1.3e-19|26.8|164/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 2 RP:SCP:REP 40->84|1sdoA|2e-04|11.1|45/192|c.52.1.21| RP:SCP:REP 58->262|2r6gG1|5e-18|18.0|205/284|f.58.1.1| OP:NHOMO 1547 OP:NHOMOORG 629 OP:PATTERN 111-1-----------2-11-1-1311-4-1------1-----1------1---131-112------- -11-31-----1---------2--14-----11111312311-1-1-1-32---1-------3-2--3222-------1---3-----1111-1-------------1----------------1-------1---11122--122--11--12322---------22222-------------21--11-11-111-122111112111-22--11212231111111116311111111111111-111112112111-11111111111-11111111111111111111111111111111111111111111111111--111222213312111111221112113111-33--11---------11---1112-------BAC222435335555555355B-226225238K1-B99G35BA9BAAD6---25EA8BBC77111111111---1125-----------------------------1---1-1333277775932332AADC55451687D4142--22233-1123C54E113----211222222221--1114---41--222311------------12-1---------------------------224-412----1111111112121311211------1------24331323334344433-3333344323343333333555551113343434333343433222333332-244434444444---------11111-225222433111111111------11231154444575546452566111111111-222111111121221111111111-------122111111111111-12111-1---1--11----111----11111112121-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-------------1------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 77.0 SQ:SECSTR #######################cHHHHHHHHHHHHHHTTccEEEEEEcTTcHHHHHHTTcEEEcccTTccHHHHHHHHHHHHHHHTccEEEEEEcccccTTccHHcHHHHHHHHHHcccEEEEEEETTcTTTHHHHHHHHHHHccccEEEEEcGGGccccHHcHHcHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHcccGGGccH######################################## DISOP:02AL 1-20, 273-274| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccc //