Thermobifida fusca YX (tfus0)
Gene : AAZ54334.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:BLT:SWISS 33->125 RTL1_HUMAN 3e-04 36.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54334.1 GT:GENE AAZ54334.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 334783..335232 GB:FROM 334783 GB:TO 335232 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54334.1 GB:DB_XREF GI:71914432 LENGTH 149 SQ:AASEQ MTRRPLCSEGQCREERREGRRHGTRNSSVPPRTSATGGSGTGDRAPAETPRVRTRNPRSAPGDAAARLPTSLSCGGSPRKIPPLGVLRHGSGAGRKSCPKRGEPPCVDGHHTRRRETSGQQSPLRFPSMRTETHRQRGDSGGRGDGRFV GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 33->125|RTL1_HUMAN|3e-04|36.3|91/100| SEG 9->25|egqcreerregrrhgtr| SEG 135->147|rqrgdsggrgdgr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-64, 91-103, 112-149| PSIPRED cccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccEEEccccccccccccccccccccccccHHHccccccccccccccHHHHHHHccccccccccccc //