[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54343.1
DDBJ      :             amino acid ABC transporter, inner membrane subunit
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  695/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:212 amino acids
:PSIPRED
:RPS:SCOP  44->211 2r6gG1  f.58.1.1 * 8e-19 13.7 %
:HMM:PFM   34->209 PF00528 * BPD_transp_1 2.4e-19 19.4 175/185  
:HMM:PFM   9->57 PF01594 * UPF0118 0.00059 34.7 49/327  
:BLT:SWISS 2->203 Y4TG_RHISN 7e-35 41.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54343.1 GT:GENE AAZ54343.1 GT:PRODUCT amino acid ABC transporter, inner membrane subunit GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 342303..342941 GB:FROM 342303 GB:TO 342941 GB:DIRECTION + GB:PRODUCT amino acid ABC transporter, inner membrane subunit GB:PROTEIN_ID AAZ54343.1 GB:DB_XREF GI:71914441 InterPro:IPR010065 LENGTH 212 SQ:AASEQ MTWDWEFTGRIIPDLLNGLAVTVQATVLGYTLALVLGLAVALVRRIPVIGTAVFAVMEFIRCTPLLVQLVFVFSLAPNTLSAFTIGVAVLGVHYAAYTAEVYRSGIEAVPAGQWEACRALSLPLHRTWGAVILPQAIRRVIPPLGNYLIAMFKDTPLLFAITVGELMYQASQIGGVYFRYLEAMTLVGLFFLLVSVPSAILIRQLERRYAAV GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 2->203|Y4TG_RHISN|7e-35|41.1|202/231| TM:NTM 4 TM:REGION 22->43| TM:REGION 69->91| TM:REGION 116->137| TM:REGION 185->206| SEG 25->43|atvlgytlalvlglavalv| HM:PFM:NREP 2 HM:PFM:REP 34->209|PF00528|2.4e-19|19.4|175/185|BPD_transp_1| HM:PFM:REP 9->57|PF01594|0.00059|34.7|49/327|UPF0118| RP:SCP:NREP 1 RP:SCP:REP 44->211|2r6gG1|8e-19|13.7|168/284|f.58.1.1| OP:NHOMO 4243 OP:NHOMOORG 729 OP:PATTERN 11--12----------1-1111114--11-2211----1122--2212--1-1----2------2--- ----4313333321411----6--1D------766636C914225273433-769135--2121577B5A3744465521421---------------------------11111111111111-----1--4---222441111-22232233321-11-1--1--3322-211---1111-1341111--25455555875566556623398556333454344444396222222222222222222246656AA775566666A93757A53338888666499888788778886666566666666747A98777813447564545523234442333212214233199-4122-1111111161--11133443421L56121311112364336456Q-22D22C26EK23jRRORUUUTfLLM9---15I657845C1111111134511-37----------111111111111111--1-4--21-4GEAGMJJJLKB8BBCDDIRDCDDACHFb77741297C84854A9EFLP234----943322222---24-11J-897C56CAAA32-23-3-------1--5-3341555553222222222-13----78B-2-----B-1111--11111111-11-1---1--------ABKI7AB9AA9998998-A9B9999999A9989988AFKDMM6667776777777777777E88788883-DBBBBBAABBBB--4-222221111--79D44443433323333233333-33454-FDDFFOJS8FHBD5LJK----------777A99999AA97711---------------2----------------3--1----------------------131-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------6-----------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //