[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54395.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->300 3cisG PDBj 1e-16 28.1 %
:RPS:PDB   9->300 3cisE PDBj 4e-25 25.3 %
:RPS:SCOP  9->152 1mjhA  c.26.2.4 * 1e-13 14.6 %
:RPS:SCOP  160->300 1mjhA  c.26.2.4 * 2e-07 14.5 %
:HMM:SCOP  9->149 2gm3A1 c.26.2.4 * 8.9e-25 36.0 %
:HMM:SCOP  159->300 2gm3A1 c.26.2.4 * 3.5e-35 38.0 %
:RPS:PFM   9->148 PF00582 * Usp 8e-04 32.8 %
:HMM:PFM   9->149 PF00582 * Usp 3.4e-22 30.9 136/140  
:HMM:PFM   160->300 PF00582 * Usp 1.6e-28 34.8 138/140  
:BLT:SWISS 9->300 Y2019_MYCBO 9e-14 28.5 %
:REPEAT 2|9->93|162->246
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54395.1 GT:GENE AAZ54395.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(400787..401689) GB:FROM 400787 GB:TO 401689 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54395.1 GB:DB_XREF GI:71914493 InterPro:IPR006015 LENGTH 300 SQ:AASEQ MADTPTGWVVVGVDGSASSRYALEWSAHEARLRGLGLRIVTAVEIPDPRDPLAGPAIPANVEELPLFQDARALLDYADRWIQRVYPELETRTRVALRRPAEALMEAAEEPGTELVVVGSRGRGTLASAFAGSVGVELAAHSPVPVVVLPKEHETAPGVRERVILGVDGSPASRNAIDFAFTEAQRRGTELVVVCAWQPITAFALTMGPLPPEIFDEEPLAEAAQQTIEEAIADYRKRYPDVSVTVRTVRAHPAAGLLETATPADLIVVGSRGRGGFRGLLLGSVSQAVLHGARGPVAVVR GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 9->300|Y2019_MYCBO|9e-14|28.5|274/317| NREPEAT 1 REPEAT 2|9->93|162->246| SEG 95->110|alrrpaealmeaaeep| SEG 220->232|aeaaqqtieeaia| SEG 267->285|vvgsrgrggfrglllgsvs| BL:PDB:NREP 1 BL:PDB:REP 9->300|3cisG|1e-16|28.1|281/292| RP:PDB:NREP 1 RP:PDB:REP 9->300|3cisE|4e-25|25.3|281/291| RP:PFM:NREP 1 RP:PFM:REP 9->148|PF00582|8e-04|32.8|131/139|Usp| HM:PFM:NREP 2 HM:PFM:REP 9->149|PF00582|3.4e-22|30.9|136/140|Usp| HM:PFM:REP 160->300|PF00582|1.6e-28|34.8|138/140|Usp| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF00582|IPR006016| RP:SCP:NREP 2 RP:SCP:REP 9->152|1mjhA|1e-13|14.6|137/143|c.26.2.4| RP:SCP:REP 160->300|1mjhA|2e-07|14.5|132/143|c.26.2.4| HM:SCP:REP 9->149|2gm3A1|8.9e-25|36.0|139/0|c.26.2.4|1/2|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 159->300|2gm3A1|3.5e-35|38.0|142/0|c.26.2.4|2/2|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 111 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- ---11--------111133-33--5433333335651463------1-1---2--1----322---7-2131111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 300 STR:RPRED 100.0 SQ:SECSTR TTTTTTTEEEEEccccHHHHHHHHHHHHHHHHHTccEEEEEEcccccccTTcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHGGHHGGGEEEEEEEcccTTccTTccccHHHHHHHHHccccEEEETTcccccccccccEEEEccccHHHHHHHHHHHHHHHHTTccEEEEEEccccccTTcccHGGTTccccHHHHHHHHHHHHHHHHTTHHHHcTTccEEEEEEcccHHHHHHHHGGGccEEEEEcccccccTTccccHHHHHHHHHccccEEEEc DISOP:02AL 1-3| PSIPRED cccccccEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEEEccccccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHccccEEEEcccccccHHHHEEcHHHHHHHHHccccEEEEEcccccccccccEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEEcccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHccccEEEEEcccccHHHHEEEcHHHHHHHHHccccEEEEc //