Thermobifida fusca YX (tfus0)
Gene : AAZ54401.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:235 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54401.1 GT:GENE AAZ54401.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 409083..409790 GB:FROM 409083 GB:TO 409790 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54401.1 GB:DB_XREF GI:71914499 LENGTH 235 SQ:AASEQ MSYTARALGVTAAGLLAFGLASAPASALELDLGADLGIATLDAEVGILTNGNDGGDDTPGETPGGGNPGGEDPGPGDNPTPEPPGGGEDPGGGDPGGGDPGGGDPGGGDPGGGDPGGGDPGGGDPGGGDPGGGDPGGGDPGTPEPEPEPEPTPAPGDGEDPDDKNPGQQPGDGSGEDGDADDNKGSSDDKKSDKADETLPVTGVDLSGFVLGASLTTAVGAITIVASRRPAQARN GT:EXON 1|1-235:0| SEG 5->28|aralgvtaagllafglasapasal| SEG 51->163|gndggddtpgetpgggnpggedpgpgdnptpeppgggedpgggdpgggdpgggdpgggdpgggdpgggdpgggdpgggdpgggdpgggdpgtpepepepeptpapgdgedpdd| SEG 171->196|gdgsgedgdaddnkgssddkksdkad| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 21-228, 230-235| PSIPRED ccccccHHcccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //