[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54409.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  159/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.31.1
:95 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  8->49 1iciA  c.31.1.5 * 4e-04 40.5 %
:RPS:PFM   1->39 PF09723 * CxxC_CxxC_SSSS 3e-11 59.0 %
:HMM:PFM   1->41 PF09723 * CxxC_CxxC_SSSS 1.5e-19 53.7 41/42  
:HMM:PFM   40->93 PF12042 * RP1-2 0.00049 29.6 54/168  
:BLT:SWISS 3->41 SPRTL_BACSU 4e-04 36.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54409.1 GT:GENE AAZ54409.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(416936..417223) GB:FROM 416936 GB:TO 417223 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54409.1 GB:DB_XREF GI:71914507 LENGTH 95 SQ:AASEQ MPTYQYACTECGADLEVVQSFSDDPLTTCPKCQGKLRKVYSAVGIVFKGSGFYRTDNASSSSSSLSSSSSSAKADSSSSGSASSSSDSSKTTSAA GT:EXON 1|1-95:0| BL:SWS:NREP 1 BL:SWS:REP 3->41|SPRTL_BACSU|4e-04|36.8|38/100| SEG 58->94|asssssslssssssakadssssgsassssdsskttsa| RP:PFM:NREP 1 RP:PFM:REP 1->39|PF09723|3e-11|59.0|39/41|CxxC_CxxC_SSSS| HM:PFM:NREP 2 HM:PFM:REP 1->41|PF09723|1.5e-19|53.7|41/42|CxxC_CxxC_SSSS| HM:PFM:REP 40->93|PF12042|0.00049|29.6|54/168|RP1-2| RP:SCP:NREP 1 RP:SCP:REP 8->49|1iciA|4e-04|40.5|37/256|c.31.1.5| OP:NHOMO 160 OP:NHOMOORG 160 OP:PATTERN -------------------------------------------------------------------- 11-11---------11111-111111111111111111111-11111111-1111111---11111-1111-11111-----------------------------------------------11111111111111111---11------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1--------11----------------------------------------------------------------------------------------------------------------------------1---1-1111-1-11111111111111111111----1-----11----------------------1111-1111-----------1--1-1--------11-------------------------11--1--1---------------------------1111----------1--------------------------------------------------------1----------------------------------1-1---------------------------11-----111--------------------------------------------------111------------1---------------------------1111111111--- -------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 54-95| PSIPRED ccccccccccccHHHHHHHcccccHHHccccccccEEEEEccccEEEccccEEEEcccccccccccccccccccccccccccccccccccccccc //