[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54410.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  317/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.124.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   67->206 1ydmB PDBj 1e-11 31.9 %
:RPS:SCOP  59->204 1sbqA  c.124.1.6 * 3e-29 21.4 %
:HMM:SCOP  24->210 1souA_ c.124.1.6 * 3.7e-45 41.4 %
:RPS:PFM   52->203 PF01812 * 5-FTHF_cyc-lig 8e-17 40.4 %
:HMM:PFM   26->204 PF01812 * 5-FTHF_cyc-lig 3.4e-38 36.9 179/186  
:BLT:SWISS 67->210 YGFA_ECOLI 2e-14 34.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54410.1 GT:GENE AAZ54410.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(417407..418051) GB:FROM 417407 GB:TO 418051 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54410.1 GB:DB_XREF GI:71914508 LENGTH 214 SQ:AASEQ MSASGCCRCGPVPLADWVSMDTGQSKRELRRRILAARRARSAQERAAAGLRIRDAVLELCAATGSPTVAAYYAVGSEPDTRSLVAALAARGHRVLLPIVTPSGDLDWAVYTGPESLAPAGHGLLEPTGTRLGADAVAEARVLVCPALAADRAGYRLGRGAGCYDRVLAAAGEQTLSLAVVYDDELVDAVPVEPHDRPVRAVVTPGRGIVWTHHR GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 67->210|YGFA_ECOLI|2e-14|34.7|144/182| SEG 27->48|relrrrilaarrarsaqeraaa| BL:PDB:NREP 1 BL:PDB:REP 67->206|1ydmB|1e-11|31.9|135/179| RP:PFM:NREP 1 RP:PFM:REP 52->203|PF01812|8e-17|40.4|151/181|5-FTHF_cyc-lig| HM:PFM:NREP 1 HM:PFM:REP 26->204|PF01812|3.4e-38|36.9|179/186|5-FTHF_cyc-lig| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF01812|IPR002698| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF01812|IPR002698| GO:PFM GO:0030272|"GO:5-formyltetrahydrofolate cyclo-ligase activity"|PF01812|IPR002698| RP:SCP:NREP 1 RP:SCP:REP 59->204|1sbqA|3e-29|21.4|126/164|c.124.1.6| HM:SCP:REP 24->210|1souA_|3.7e-45|41.4|181/194|c.124.1.6|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 330 OP:NHOMOORG 325 OP:PATTERN -------------------------------------------1111-------------------11 ----11111111111--11-11111111111111111111111111111111111111111111111111111111111---1--1111111-111------------11----------------------1-11-----------1--11-----------1-1-------------------------------------------1----1--------11-----------------------------------1-----------1--1---111----------------------------------111----------------1--------------1---11--111---11---1-----1---1-1-1211--------1-111111111111-1121131111--1111111121111-1-1--------1---------1---1--1------------------------------11--------------11111----11111------------1------------1-----11--1--------1------11--1111111-1111-11----11-----------------------------11----11-111-------111--1-------1----------1-111111111111111-111111111111111111111111---1111111111111111111111111--11111111111---111111---11----11111------1------------------------------------------11111111111111----------------------------------------------------------------------1-- ------1---------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 69.6 SQ:SECSTR ################################################################ccEEEcccccTTccccHHHHHHHHHTTcEEEEcccccccccccEEccccTTHHHHHTTcccccccccccccccGGGcEEccccEEETTccEEcccccHHHHHGGGcccEEEEEEEccGGGEEcccccccccccccEEEccccccccccc# DISOP:02AL 1-3, 213-214| PSIPRED cccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHcccEEEEEEEEccccEEEEEEccccccccccccccccccccccccccccccEEEEccEEEcccccEEEccccHHHHHHHHcccccEEEEEEEcEEEcccccccccccEEcEEEccccEEEEEEcc //