[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54422.1
DDBJ      :             cold-shock DNA-binding protein family
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  696/915 : Eukaryota  76/199 : Viruses  1/175   --->[See Alignment]
b.40.4
:67 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->64 1hzcA PDBj 3e-21 68.3 %
:RPS:PDB   1->67 1c9oA PDBj 8e-21 65.2 %
:RPS:SCOP  1->67 1c9oA  b.40.4.5 * 3e-21 65.2 %
:HMM:SCOP  1->68 1h95A_ b.40.4.5 * 2e-26 60.3 %
:RPS:PFM   2->64 PF00313 * CSD 1e-19 73.0 %
:HMM:PFM   1->66 PF00313 * CSD 7.5e-33 60.6 66/67  
:BLT:SWISS 1->67 CSPA_MYCTU 7e-25 73.1 %
:PROS 15->34|PS00352|COLD_SHOCK

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54422.1 GT:GENE AAZ54422.1 GT:PRODUCT cold-shock DNA-binding protein family GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(427452..427655) GB:FROM 427452 GB:TO 427655 GB:DIRECTION - GB:PRODUCT cold-shock DNA-binding protein family GB:PROTEIN_ID AAZ54422.1 GB:DB_XREF GI:71914520 InterPro:IPR002059 InterPro:IPR011129 LENGTH 67 SQ:AASEQ MAQGTVKWFNSEKGFGFIAVDGGGPDVFVHYSAIAGTGFRNLEENQAVEFEIVPGPKGPQAADVRAL GT:EXON 1|1-67:0| BL:SWS:NREP 1 BL:SWS:REP 1->67|CSPA_MYCTU|7e-25|73.1|67/67| PROS 15->34|PS00352|COLD_SHOCK|PDOC00304| BL:PDB:NREP 1 BL:PDB:REP 1->64|1hzcA|3e-21|68.3|63/66| RP:PDB:NREP 1 RP:PDB:REP 1->67|1c9oA|8e-21|65.2|66/66| RP:PFM:NREP 1 RP:PFM:REP 2->64|PF00313|1e-19|73.0|63/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 1->66|PF00313|7.5e-33|60.6|66/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 1->67|1c9oA|3e-21|65.2|66/66|b.40.4.5| HM:SCP:REP 1->68|1h95A_|2e-26|60.3|68/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 2485 OP:NHOMOORG 779 OP:PATTERN ------------------------2--31-1-----------------------------------11 553-711322211112222-24112222121222225474333442211223354212--443-5468862--111111-21411122-----------1-1-1---532---------------11112122311-----------1------------------1----------------32122--2123666666666666676213333667211436233333365-33333333333332222235-213311-1-4322334212212341111111--------------1111111111111-11111111312222222322312-1444211-5-112-11--11241-242111112112--33341111143B55B444444533233333233-5537534549414553655896964422243565455333333333323333333------------1111111111111----22242155555666566533324467444434557586512444221--------3212323231111111224233-4526-----1----666334653555561551-------------------1---1114433564349B433333332332333333411-121311122245445737557755-66-56855557755775576564544456655554454445555557554555531A858987687991122-----6665235452221222111111123422423334445555666656666555522222222224448444444444433333333332222115-----------------11-11----1--------1-------2311122222--- --11----------1-------1---------------------------1--------------------------------------------------1-12---4--3212121-111317816-4D2-419-1-25--321212-4-14-32-1--239211111-1121--11A211223144-4421----1 ---------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEETTTTEEEEEETTEEcEEEEEGGGccccccccccTTcEEEEEEEEETTEEEEEEEEEc PSIPRED ccccEEEEEEccccEEEEEEccccccEEEEEEEEccccccccccccEEEEEEEEcccccEEEEEEEc //