[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54432.1
DDBJ      :             putative ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   35->71 PF05426 * Alginate_lyase 0.00066 32.4 37/345  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54432.1 GT:GENE AAZ54432.1 GT:PRODUCT putative ATP-binding protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(438981..439244) GB:FROM 438981 GB:TO 439244 GB:DIRECTION - GB:PRODUCT putative ATP-binding protein GB:PROTEIN_ID AAZ54432.1 GB:DB_XREF GI:71914530 LENGTH 87 SQ:AASEQ MRSLPGLYKRVVSGSSDDALLADLFGIDSRYSVQAEEKRQRLAQLESAVPRGAATPEEIDECHGVQQAVASPFTARVDEAARRISRA GT:EXON 1|1-87:0| HM:PFM:NREP 1 HM:PFM:REP 35->71|PF05426|0.00066|32.4|37/345|Alginate_lyase| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------------------------------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 38-41, 85-87| PSIPRED ccccHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //