[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54454.1
DDBJ      :             LSU ribosomal protein L25P
Swiss-Prot:RL25_THEFY   RecName: Full=50S ribosomal protein L25;AltName: Full=General stress protein CTC;

Homologs  Archaea  0/68 : Bacteria  230/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.53.1
:194 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->176 1vsaT PDBj 4e-14 33.8 %
:RPS:PDB   6->176 3d5bZ PDBj 2e-24 31.1 %
:RPS:SCOP  3->176 1feuA  b.53.1.1 * 1e-26 30.0 %
:HMM:SCOP  2->186 1feuA_ b.53.1.1 * 1.2e-49 53.6 %
:RPS:PFM   8->90 PF01386 * Ribosomal_L25p 4e-08 46.3 %
:HMM:PFM   6->91 PF01386 * Ribosomal_L25p 1.5e-25 47.1 85/88  
:BLT:SWISS 1->176 RL25_THEFY 3e-77 100.0 %
:PROS 102->121|PS00389|ATPASE_DELTA
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54454.1 GT:GENE AAZ54454.1 GT:PRODUCT LSU ribosomal protein L25P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 468906..469490 GB:FROM 468906 GB:TO 469490 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L25P GB:PROTEIN_ID AAZ54454.1 GB:DB_XREF GI:71914552 InterPro:IPR000711 InterPro:IPR001021 LENGTH 194 SQ:AASEQ MSEVRIAAEPRTEFGKGAARRARRAGKVPAVLYGHGIAPRHINLPGHDLMLALKTPNVLLRLEGVDEKESLVLPKSVQRDPIKGFLEHVDLLVVQRGEKVVVEVPLLVKGEVGAGGVLNLEMAQAEVRAEATRIPEGIEVDVDGLPIGTNVTAGDLKLPEGVELAMDPETIVMSVVAEAAPEATEEEEEGEAAE GT:EXON 1|1-194:0| SW:ID RL25_THEFY SW:DE RecName: Full=50S ribosomal protein L25;AltName: Full=General stress protein CTC; SW:GN Name=rplY; Synonyms=ctc; OrderedLocusNames=Tfu_0416; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->176|RL25_THEFY|3e-77|100.0|176/194| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 102->121|PS00389|ATPASE_DELTA|PDOC00327| SEG 18->25|aarrarra| SEG 93->113|vvqrgekvvvevpllvkgevg| SEG 177->193|aeaapeateeeeegeaa| BL:PDB:NREP 1 BL:PDB:REP 26->176|1vsaT|4e-14|33.8|151/185| RP:PDB:NREP 1 RP:PDB:REP 6->176|3d5bZ|2e-24|31.1|167/188| RP:PFM:NREP 1 RP:PFM:REP 8->90|PF01386|4e-08|46.3|82/88|Ribosomal_L25p| HM:PFM:NREP 1 HM:PFM:REP 6->91|PF01386|1.5e-25|47.1|85/88|Ribosomal_L25p| GO:PFM:NREP 5 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01386|IPR020055| GO:PFM GO:0005622|"GO:intracellular"|PF01386|IPR020055| GO:PFM GO:0005840|"GO:ribosome"|PF01386|IPR020055| GO:PFM GO:0006412|"GO:translation"|PF01386|IPR020055| GO:PFM GO:0008097|"GO:5S rRNA binding"|PF01386|IPR020055| RP:SCP:NREP 1 RP:SCP:REP 3->176|1feuA|1e-26|30.0|170/185|b.53.1.1| HM:SCP:REP 2->186|1feuA_|1.2e-49|53.6|179/185|b.53.1.1|1/1|Ribosomal protein L25-like| OP:NHOMO 232 OP:NHOMOORG 230 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-1111111111111111111111111111111111111111111111111111111111----1--------1--------------------------------------------------------------------------1-------------------11-----1-------------------1----1-1----------111-------------------1-----------------------------------------------------------------------1-------------------------2---1---111-11111-----1-1111-1----1-----111-11111111111111---------1111111111111111--11111111111-1-------------11-111-1111----1111111111111-----1-111-----------------------------------111----------------1-----------11--1---1-----------111111-1111111----------------------------11--------1-----------------------1-111--------------------------------------------------------------------------------------------------1111-1111----------------------111--11111--1111-11------------1----------------------------11--------------------------------------------1-------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 173 STR:RPRED 89.2 SQ:SECSTR ###cEEccEEcccccHHHHHHHHHTTEEEEEEEcTTcccEEEEEEHHHHHHHHHHHTccEEEEcTTccEEEEEcccEEEETTTTEEEEEEEcccccEEEEEEEEEccccHHHHTTcccEEcccEEEEEEcTTcccccEEEcTTcccTTccEEGGGccccTTEEccccTTcEEEEcc################## DISOP:02AL 13-19, 178-194| PSIPRED ccEEEEEEEEcccccccHHHHHHHccccEEEEEccccccEEEEEcHHHHHHHHHcccEEEEEEEccccEEEEEEEEEEcccccccEEEEEEEEEccccEEEEEEEEEEEEEEccccEEEEEEEEEEEEEcHHHcccEEEEEEEccccccEEEEEEEEcccccEEEcccccEEEEEEEccccccccccccccccc //