[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54479.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:246 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 159->237 NDHJ_ACAM1 4e-04 27.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54479.1 GT:GENE AAZ54479.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 500121..500861 GB:FROM 500121 GB:TO 500861 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54479.1 GB:DB_XREF GI:71914577 LENGTH 246 SQ:AASEQ MRVSARHAALLTLPLLLFTAACEGEEDTAAPQSDAEPTPSASPSPELPTLHELVRAHIADTWEYDVDYAGRCETLSEEEEFSLIRGEGICLSLYADVGDSTVFVLGPPATEPFEALRLTTPDGEHWELVENFVIEDPYGPGPDWLDEAIRIKDDPSAWEITAPTLAEVGETWLADRYLPLDCEATGEGGPDHEAWCVHVEGSDDEENPTTDRGTVLITRNGEPYHRLFAVFTGEEWRLYDEFPATE GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 159->237|NDHJ_ACAM1|4e-04|27.8|79/100| SEG 8->21|aalltlplllftaa| SEG 35->50|aeptpsaspspelptl| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 26-46, 244-246| PSIPRED cccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccEEEEccccEEEEEEEcccccEEEEEcccccccccEEEEEcccccHHHHHHHHEEEccccccHHHHHHHEEEccccccEEEEccHHHHHHHHHHHcccccccccccccccccccEEEEEEEcccccccccccccEEEEEEcccccEEEEEEEEcccEEEEccccccc //