[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54484.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   43->187 PF06271 * RDD 5e-07 31.3 %
:HMM:PFM   43->188 PF06271 * RDD 4e-29 29.2 130/133  
:BLT:SWISS 46->189 PRA_MYCLE 1e-07 32.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54484.1 GT:GENE AAZ54484.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(506300..506884) GB:FROM 506300 GB:TO 506884 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54484.1 GB:DB_XREF GI:71914582 LENGTH 194 SQ:AASEQ MTHPHPSPAQPPSPYLGPPPPPGPFPHGAYPPPPGVFPQPPEVASWGRRVAAFLIDSVLAQVLTFGVILIGALVAALVDNIAYPEYIHSDTMSPAAITIVLTALFAAFATAIAYWSLPHAKWGKTIGKWMLGIRVIAANTGTPPSVGRALGRYFFFALLSFPMITFFVDCLWPLWDSRGQSLHDKVAGTYVIRG GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 46->189|PRA_MYCLE|1e-07|32.1|134/249| TM:NTM 3 TM:REGION 52->74| TM:REGION 94->116| TM:REGION 152->174| SEG 4->41|phpspaqppspylgpppppgpfphgayppppgvfpqpp| SEG 101->111|ltalfaafata| RP:PFM:NREP 1 RP:PFM:REP 43->187|PF06271|5e-07|31.3|131/132|RDD| HM:PFM:NREP 1 HM:PFM:REP 43->188|PF06271|4e-29|29.2|130/133|RDD| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------1------------------------1-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcEEEEEc //