[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54493.1
DDBJ      :             sigma subunit sigma24 -like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  442/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13
:236 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->229 1or7A PDBj 4e-16 32.5 %
:RPS:PDB   51->234 3dxjF PDBj 2e-18 9.2 %
:RPS:SCOP  54->163 1or7A2  a.177.1.1 * 5e-17 28.7 %
:RPS:SCOP  175->234 1ku3A  a.4.13.2 * 5e-05 16.7 %
:HMM:SCOP  52->164 1or7A2 a.177.1.1 * 5.1e-21 33.0 %
:HMM:SCOP  165->234 1or7A1 a.4.13.2 * 2.2e-06 35.8 %
:RPS:PFM   78->134 PF04542 * Sigma70_r2 2e-04 39.3 %
:RPS:PFM   176->229 PF08281 * Sigma70_r4_2 3e-05 47.1 %
:HMM:PFM   78->146 PF04542 * Sigma70_r2 1.5e-15 31.9 69/71  
:HMM:PFM   192->228 PF08281 * Sigma70_r4_2 1.7e-11 43.2 37/54  
:BLT:SWISS 56->229 RPOE_SHIFL 1e-15 31.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54493.1 GT:GENE AAZ54493.1 GT:PRODUCT sigma subunit sigma24 -like protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 515588..516298 GB:FROM 515588 GB:TO 516298 GB:DIRECTION + GB:PRODUCT sigma subunit sigma24 -like protein GB:PROTEIN_ID AAZ54493.1 GB:DB_XREF GI:71914591 LENGTH 236 SQ:AASEQ MQNLVTTGQQFGKMCQPFCGGMRVIAGRDYRQWGVSVVTKADQSSETVSPNHAPGEEESLEQLALRAKEGDEAALEELLRRIQPDVLRRCARFLPYRQDAEEACQDALMRVAANIQNFRGDSMFTTWLYTVVSNSARQTYRALKRRAAEMPTEADRLPHRTDPRTTSVIAGSRIDLLEALDQLEKDRPNLVAPLVLRDLCQMEYGEIAAQLDLALGTVKSRIHEGRKRVRQALAVN GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 56->229|RPOE_SHIFL|1e-15|31.2|170/191| BL:PDB:NREP 1 BL:PDB:REP 56->229|1or7A|4e-16|32.5|166/181| RP:PDB:NREP 1 RP:PDB:REP 51->234|3dxjF|2e-18|9.2|184/349| RP:PFM:NREP 2 RP:PFM:REP 78->134|PF04542|2e-04|39.3|56/70|Sigma70_r2| RP:PFM:REP 176->229|PF08281|3e-05|47.1|51/54|Sigma70_r4_2| HM:PFM:NREP 2 HM:PFM:REP 78->146|PF04542|1.5e-15|31.9|69/71|Sigma70_r2| HM:PFM:REP 192->228|PF08281|1.7e-11|43.2|37/54|Sigma70_r4_2| GO:PFM:NREP 10 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 2 RP:SCP:REP 54->163|1or7A2|5e-17|28.7|108/113|a.177.1.1| RP:SCP:REP 175->234|1ku3A|5e-05|16.7|60/61|a.4.13.2| HM:SCP:REP 52->164|1or7A2|5.1e-21|33.0|112/113|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 165->234|1or7A1|2.2e-06|35.8|67/68|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 670 OP:NHOMOORG 443 OP:PATTERN -------------------------------------------------------------------- 687-232422233342211-121124122122233334331111222-2---111111--1-414333353---------1-1-----225------------121112-------------------1-----1-12232---4--21-111--11------1-11-----------------1---11-31311111--1-------212212----111131------84-------------------------------------------------------------------------------------------12--1111111-1-1---------1--9--2111213211-21-2-1--8-21----------111---------------------------1-3--111-212122--22--1---2-1---1--------1-------------------------------------11---111111112111111111221111111121111--33-1112111121121112111--------111111111---1-----------1--21-332346-3-------------------------11111-11212211111121311121121222---1112------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--12---------11211111111111111111----------1222222222222222222----------1111111111111111111112121111--2---2211------------------------------------1111--1---122 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 78.0 SQ:SECSTR ##################################################HHHHHTccHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTcccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHHHH## DISOP:02AL 1-2, 34-58, 235-236| PSIPRED cccHHHHHHHHHHHHcHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccc //