[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54521.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   16->110 PF11255 * DUF3054 5e-12 52.6 %
:HMM:PFM   6->110 PF11255 * DUF3054 3.3e-31 42.9 105/112  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54521.1 GT:GENE AAZ54521.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(550441..550815) GB:FROM 550441 GB:TO 550815 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54521.1 GB:DB_XREF GI:71914619 LENGTH 124 SQ:AASEQ MRSVSAAVVDAAVVVLFVLIGRSSHGEPNTLIDVVTTLWPFAASLALGWIVARAWQMPVAPLRTGVGVWAITVAAGMALRALSGGGIAVSFIVVASLFLAAGLIGWRVVATLVLSRRTTTPTPH GT:EXON 1|1-124:0| TM:NTM 4 TM:REGION 1->22| TM:REGION 30->52| TM:REGION 64->86| TM:REGION 93->115| SEG 3->15|svsaavvdaavvv| RP:PFM:NREP 1 RP:PFM:REP 16->110|PF11255|5e-12|52.6|95/111|DUF3054| HM:PFM:NREP 1 HM:PFM:REP 6->110|PF11255|3.3e-31|42.9|105/112|DUF3054| OP:NHOMO 37 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ---1----------11111-11111111111111111111-----11-11111-11-1------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 117-124| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //