[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54525.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54525.1 GT:GENE AAZ54525.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 555449..555973 GB:FROM 555449 GB:TO 555973 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54525.1 GB:DB_XREF GI:71914623 LENGTH 174 SQ:AASEQ MTSSAEHTGERAEPGAEATAGLDRRLMGMLAALNIVFLAALGLVGGIVAGLCAGWASWLWLTGTIGQLLSVATVLLFLLVLFSGARVIGWAVGAKWGPGAFAAGWILAGVLLTGYVAGGDVVMTSTVPTYLFLYGGVGAVIVATVLTPETGDKVTTDGGTSAPTRGTATPPQSD GT:EXON 1|1-174:0| TM:NTM 4 TM:REGION 30->52| TM:REGION 66->88| TM:REGION 101->123| TM:REGION 129->151| SEG 38->54|laalglvggivaglcag| SEG 68->83|llsvatvllfllvlfs| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17, 164-174| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHcHHHHHHHHHHccccccEEEccccccccccccccccccc //