[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54534.1
DDBJ      :             Conserved hypothetical protein 730
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  458/915 : Eukaryota  34/199 : Viruses  0/175   --->[See Alignment]
c.129.1
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->240 1wekB PDBj 5e-46 48.0 %
:RPS:PDB   66->240 2a33B PDBj 3e-31 26.1 %
:RPS:SCOP  66->239 1wehA  c.129.1.1 * 6e-60 30.9 %
:HMM:SCOP  34->241 1wekA_ c.129.1.1 * 6.7e-69 46.4 %
:RPS:PFM   67->126 PF02481 * DNA_processg_A 6e-06 32.8 %
:RPS:PFM   109->239 PF03641 * Lysine_decarbox 8e-28 50.0 %
:HMM:PFM   109->239 PF03641 * Lysine_decarbox 1.4e-38 40.8 130/133  
:HMM:PFM   65->125 PF02481 * DNA_processg_A 2.9e-05 28.8 59/212  
:BLT:SWISS 66->239 Y4923_PSEAE 6e-14 32.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54534.1 GT:GENE AAZ54534.1 GT:PRODUCT Conserved hypothetical protein 730 GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 563593..564402 GB:FROM 563593 GB:TO 564402 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein 730 GB:PROTEIN_ID AAZ54534.1 GB:DB_XREF GI:71914632 InterPro:IPR005269 LENGTH 269 SQ:AASEQ MTDSRSIERQAGPLTYRGREIPKSTTDQRLLDRRGPTDWVHTDPWRVLRIQSEFVEGFGMLSEVGRAVCVFGSARIKPETPYYELGEEIGRKLVEAGYTVITGGGPGLMEAANKGAADVGGTSIGLGIELPFEQSLNDYVNLGVVFRYFFVRKTMFVKYSQAFVVLPGGFGTLDELFEALTLVQTGKITRFPVILVGTDFWGGLVEWINDRLLAEGLISPSDPDLIHLTDDPDDVIETIQRAHAEWERALEEEEAVTELEEALREAEHS GT:EXON 1|1-269:0| BL:SWS:NREP 1 BL:SWS:REP 66->239|Y4923_PSEAE|6e-14|32.9|167/195| SEG 241->267|rahaeweraleeeeavteleealreae| BL:PDB:NREP 1 BL:PDB:REP 41->240|1wekB|5e-46|48.0|198/206| RP:PDB:NREP 1 RP:PDB:REP 66->240|2a33B|3e-31|26.1|165/170| RP:PFM:NREP 2 RP:PFM:REP 67->126|PF02481|6e-06|32.8|58/209|DNA_processg_A| RP:PFM:REP 109->239|PF03641|8e-28|50.0|128/131|Lysine_decarbox| HM:PFM:NREP 2 HM:PFM:REP 109->239|PF03641|1.4e-38|40.8|130/133|Lysine_decarbox| HM:PFM:REP 65->125|PF02481|2.9e-05|28.8|59/212|DNA_processg_A| GO:PFM:NREP 1 GO:PFM GO:0009294|"GO:DNA mediated transformation"|PF02481|IPR003488| RP:SCP:NREP 1 RP:SCP:REP 66->239|1wehA|6e-60|30.9|165/171|c.129.1.1| HM:SCP:REP 34->241|1wekA_|6.7e-69|46.4|207/0|c.129.1.1|1/1|MoCo carrier protein-like| OP:NHOMO 664 OP:NHOMOORG 496 OP:PATTERN -----------------------11--------1-------------------1-------------- 221121112222121-------11-2------1---1111111111111---111111--111-2111211-111111----121111111--------112121112-1-------1-1----2331213221231111111111131211111111-1--11-1111111--111--11-1--111--1--111111111111111111-111111-111------------1111111111111111111--------------------111-11-------------------------------------------1-----1111111-1---11-------------------------------111111111111-1112--2-111122222222222-11-11-1-22--222211122211--21121122221221111111111111111------------------------------21111122213223221212233232222-22222223112221112311112111-1111211111111121222-12111221221111111121121--1---11-1111111111---------1111111-------1--------------------1----2111--------1----------------------------------111----------------------------------------------------1111--------------------11111-11--1-22222211211111111111111111---------------1-11111111------11111111-----------------------------------------1-1--111 1-------311---2-----------------------------------------------1--1----11-1-----11------------1------1--1----32------------------------------------------------1----1---------4-21--A111-1146D-52-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 77.7 SQ:SECSTR ###############################HHccHHHHHHccHHHHHHHHHHHHHHTTcccTTccEEEEEccccccccHHHHHHHHHHHHHHHHTTcEEEEcccccHHHHHHHHHHHTTccEEEEEEEEEccccccEEccEEEEEEEccHHHHHHHHTccEEEEccccHHHHHHHHHHHHHHHTTcccccEEEEcGGGTTHHHHHHHHHHHHHTTcccHHHHTTEEEEccHHHHHHHHH############################# DISOP:02AL 1-13, 263-269| PSIPRED cccHHHHHHHHcHHHHHHHcccccccHHHHHHccccHHHHcccccHHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHcccEEEEEcccccccccccccccEEEEEccHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHcccccHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //