[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54542.1
DDBJ      :             RNA polymerase sigma-70 factor, ECF subfamily
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  508/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13a.4.6
:191 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->164 1or7A PDBj 1e-11 34.2 %
:RPS:PDB   12->164 3dxjF PDBj 1e-22 13.2 %
:RPS:SCOP  17->83 1h3lA  a.177.1.1 * 1e-17 35.8 %
:RPS:SCOP  107->164 1p4wA  a.4.6.2 * 2e-07 22.8 %
:HMM:SCOP  18->106 1or7A2 a.177.1.1 * 7.5e-20 42.0 %
:HMM:SCOP  110->177 1or7A1 a.4.13.2 * 1.3e-15 39.7 %
:RPS:PFM   29->85 PF04542 * Sigma70_r2 1e-11 52.6 %
:RPS:PFM   124->164 PF08281 * Sigma70_r4_2 2e-06 51.2 %
:HMM:PFM   22->87 PF04542 * Sigma70_r2 6.4e-23 45.5 66/71  
:HMM:PFM   121->171 PF08281 * Sigma70_r4_2 3.6e-20 45.1 51/54  
:BLT:SWISS 28->162 RPOE_MYCTU 6e-17 36.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54542.1 GT:GENE AAZ54542.1 GT:PRODUCT RNA polymerase sigma-70 factor, ECF subfamily GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 571138..571713 GB:FROM 571138 GB:TO 571713 GB:DIRECTION + GB:PRODUCT RNA polymerase sigma-70 factor, ECF subfamily GB:PROTEIN_ID AAZ54542.1 GB:DB_XREF GI:71914640 LENGTH 191 SQ:AASEQ MADPAPAADFGHWEPPSWEEVVRTHSARVYRLAYRLTGNQHDAEDLTQEVFIRVFRSLANYTPGTFEGWLHRITTNLFLDMARRRSRIRFEGLAETANDRLEGREPSPAQAYDDRHFDADVQAALDALSPEFRAAVVLCDIEGLSYEEIAATLGVKLGTVRSRIHRGRAQLRAALQHRRQAAERVGEVTEA GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 28->162|RPOE_MYCTU|6e-17|36.6|134/216| SEG 165->182|hrgraqlraalqhrrqaa| BL:PDB:NREP 1 BL:PDB:REP 42->164|1or7A|1e-11|34.2|117/181| RP:PDB:NREP 1 RP:PDB:REP 12->164|3dxjF|1e-22|13.2|152/349| RP:PFM:NREP 2 RP:PFM:REP 29->85|PF04542|1e-11|52.6|57/70|Sigma70_r2| RP:PFM:REP 124->164|PF08281|2e-06|51.2|41/54|Sigma70_r4_2| HM:PFM:NREP 2 HM:PFM:REP 22->87|PF04542|6.4e-23|45.5|66/71|Sigma70_r2| HM:PFM:REP 121->171|PF08281|3.6e-20|45.1|51/54|Sigma70_r4_2| GO:PFM:NREP 10 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 2 RP:SCP:REP 17->83|1h3lA|1e-17|35.8|67/75|a.177.1.1| RP:SCP:REP 107->164|1p4wA|2e-07|22.8|57/87|a.4.6.2| HM:SCP:REP 18->106|1or7A2|7.5e-20|42.0|88/113|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 110->177|1or7A1|1.3e-15|39.7|68/68|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 1227 OP:NHOMOORG 508 OP:PATTERN -------------------------------------------------------------------- AEK2C43444443264423-24113922222366664445432355112211333112--225154654551111111--5-4-----4452-311-----2--674623---------------2222111113154466--19342222222211------23241111------------121--11-21233333224-4442142244424242212322------H7------------------------------------------------------------------------------------------14111-------1--3-11----114--D1-2167315311-21-1-2--C-44112-1---1353321331233----------3-44A54947-43-11142231344424221122213211211111111-2211-1-------------------------------13351222224223242112122331122124122142-112121122212341222221111-------211223-22--11--2-----12-1--31-4465AB13-------------------------11111226223112333322233331323333---1112----------1--1111111111-1111111111111111111-----11------------------11111111----------------5-----1111111-11111-111-1-1111------1---12----2222-21221223---------11--1111111211132121221-11111--31--1111-------------------------------------111-111-1262 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 84.3 SQ:SECSTR ###ccccccHHHHHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHTHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTcc########################### DISOP:02AL 174-191| PSIPRED cccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //