[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54543.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.180.1
:212 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  5->70 1or7C  a.180.1.1 * 1e-08 27.0 %
:HMM:PFM   5->28 PF03872 * RseA_N 0.0003 47.6 21/87  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54543.1 GT:GENE AAZ54543.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 571710..572348 GB:FROM 571710 GB:TO 572348 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID AAZ54543.1 GB:DB_XREF GI:71914641 LENGTH 212 SQ:AASEQ MSHLEEQLSAFIDGELGHSERERVLSHLARCEPCRFEAAMLRQLKQRLCTLRPPEPASEFLTRLLALPEATTGDPPAPPSGFGASPPLGAGQPLGGLPLPRPERRPAPARGLFRFRGEWGRARYAVAGVSMLAAALGTAFLAGGDPAEPPVVTPALTDYAIEHAAVSGQSPLGDPATVPVVTRPLSPHDAPTVQVVQTVNRGVMRSDTPEHR GT:EXON 1|1-212:0| SEG 73->112|gdppappsgfgaspplgagqplgglplprperrpapargl| SEG 132->144|laaalgtaflagg| HM:PFM:NREP 1 HM:PFM:REP 5->28|PF03872|0.0003|47.6|21/87|RseA_N| RP:SCP:NREP 1 RP:SCP:REP 5->70|1or7C|1e-08|27.0|63/66|a.180.1.1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------------------------------------1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 66-81, 204-212| PSIPRED ccHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccccccEEEccccccccHHHHHHHHHHHHHHcccccccc //