[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54556.1
DDBJ      :             transcriptional regulator, TetR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  67/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->199 2qibA PDBj 8e-14 32.1 %
:RPS:PDB   30->199 3br5D PDBj 8e-21 13.6 %
:RPS:SCOP  30->90 1z77A1  a.4.1.9 * 4e-14 36.1 %
:RPS:SCOP  90->199 2genA2  a.121.1.1 * 3e-07 18.2 %
:HMM:SCOP  7->95 1t33A1 a.4.1.9 * 3.4e-21 39.8 %
:HMM:SCOP  89->201 2genA2 a.121.1.1 * 2e-25 35.4 %
:RPS:PFM   30->69 PF00440 * TetR_N 2e-05 50.0 %
:HMM:PFM   23->69 PF00440 * TetR_N 1.2e-20 57.4 47/47  
:BLT:SWISS 30->66 ICAR_STAAW 3e-04 37.8 %
:BLT:SWISS 40->200 Y472_MYCTU 1e-08 22.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54556.1 GT:GENE AAZ54556.1 GT:PRODUCT transcriptional regulator, TetR family GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(585534..586154) GB:FROM 585534 GB:TO 586154 GB:DIRECTION - GB:PRODUCT transcriptional regulator, TetR family GB:PROTEIN_ID AAZ54556.1 GB:DB_XREF GI:71914654 InterPro:IPR001647 LENGTH 206 SQ:AASEQ MTAPSEAQPRGTRLPRIARRRQLLAAAQQVFVERGYHAAAMDEIAERAGVSKPVLYQHFPGKLELYLALLEQHSEALVEKQRAALQSTDDNWQRVVASFKAYFDFVSGEGGAFRLVFESDLRNLPAVREITEQTTLRCAELIGEVIRQDTSVSDEEAHLLSIGLVGMAETSARYWLSRGTIPKDAAEQLIARLAWRGISGWDLTRH GT:EXON 1|1-206:0| BL:SWS:NREP 2 BL:SWS:REP 30->66|ICAR_STAAW|3e-04|37.8|37/186| BL:SWS:REP 40->200|Y472_MYCTU|1e-08|22.4|161/234| SEG 13->29|rlpriarrrqllaaaqq| BL:PDB:NREP 1 BL:PDB:REP 30->199|2qibA|8e-14|32.1|162/217| RP:PDB:NREP 1 RP:PDB:REP 30->199|3br5D|8e-21|13.6|169/183| RP:PFM:NREP 1 RP:PFM:REP 30->69|PF00440|2e-05|50.0|40/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 23->69|PF00440|1.2e-20|57.4|47/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 30->90|1z77A1|4e-14|36.1|61/75|a.4.1.9| RP:SCP:REP 90->199|2genA2|3e-07|18.2|110/118|a.121.1.1| HM:SCP:REP 7->95|1t33A1|3.4e-21|39.8|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 89->201|2genA2|2e-25|35.4|113/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 144 OP:NHOMOORG 67 OP:PATTERN -------------------------------------------------------------------- ----3111111---23322-23223322222333433534-111212-2---122112--331-44455331111111------------------------------------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------1------------------------------------------------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 85.4 SQ:SECSTR #############################HHHHHccTTccHHHHHHHHTccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHTTGGGcccHHHHHHHHHHHHHHccccTTTHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccGGGc# DISOP:02AL 1-21, 202-206| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccc //