[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54560.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  63/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.2
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->62 2kifA PDBj 8e-08 37.9 %
:RPS:PDB   1->85 1eh6A PDBj 2e-11 22.4 %
:RPS:SCOP  9->85 1eh6A1  a.4.2.1 * 1e-13 24.7 %
:HMM:SCOP  4->82 1sfeA1 a.4.2.1 * 2e-13 35.4 %
:RPS:PFM   7->63 PF01035 * DNA_binding_1 5e-04 49.1 %
:HMM:PFM   6->82 PF01035 * DNA_binding_1 4.2e-25 37.7 77/85  
:BLT:SWISS 1->98 YBAZ_SHIFL 5e-09 40.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54560.1 GT:GENE AAZ54560.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 588524..588850 GB:FROM 588524 GB:TO 588850 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54560.1 GB:DB_XREF GI:71914658 LENGTH 108 SQ:AASEQ MPLPDDYVERVLHVVESIPPGKVMSYGDVAEYLGEGGPRQVGSVLATWGGAVPWWRVVRADGSPPKGHEVAALAHYAAEGTPLRRGVARVDMAQARWDGKHAAEQVDP GT:EXON 1|1-108:0| BL:SWS:NREP 1 BL:SWS:REP 1->98|YBAZ_SHIFL|5e-09|40.4|94/129| BL:PDB:NREP 1 BL:PDB:REP 5->62|2kifA|8e-08|37.9|58/102| RP:PDB:NREP 1 RP:PDB:REP 1->85|1eh6A|2e-11|22.4|85/168| RP:PFM:NREP 1 RP:PFM:REP 7->63|PF01035|5e-04|49.1|57/85|DNA_binding_1| HM:PFM:NREP 1 HM:PFM:REP 6->82|PF01035|4.2e-25|37.7|77/85|DNA_binding_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01035|IPR014048| GO:PFM GO:0006281|"GO:DNA repair"|PF01035|IPR014048| RP:SCP:NREP 1 RP:SCP:REP 9->85|1eh6A1|1e-13|24.7|77/90|a.4.2.1| HM:SCP:REP 4->82|1sfeA1|2e-13|35.4|79/0|a.4.2.1|1/1|Methylated DNA-protein cysteine methyltransferase, C-terminal domain| OP:NHOMO 64 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------------- ----1-11111----1111-11--1111111111111111-111112--111111111--1111-111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 78.7 SQ:SECSTR HHcccHHHHHHHHHHHHccTTccEEHHHHHHHTTTTcHHHHHHHTTcccTTccGGGEEcTTccccTTcHHHHHHHHHHTTccccc####################### DISOP:02AL 101-108| PSIPRED cccccHHHHHHHHHHHHcccccEEcHHHHHHHHccccHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHcccEEcccccEEcHHHHccccccccccccc //