[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54578.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 35->129 KHSE_THENV 4e-04 30.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54578.1 GT:GENE AAZ54578.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(612208..612732) GB:FROM 612208 GB:TO 612732 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54578.1 GB:DB_XREF GI:71914676 LENGTH 174 SQ:AASEQ MSFNLREAVLGLERHAAKQGWDQPVRMYALVPTAELVQREPHLAELLGISEEADPSGLTPVEQEPLPSDMPLEEVLGRIMWPETVAGCALVMERLVVRGSDETLDPPRDGDTAAWAQAQPGAEEVRMVAGVLRDGSRYSALRMRSYDSDDQVLNGEDLIPGLTSALTLTFEEDH GT:EXON 1|1-174:0| BL:SWS:NREP 1 BL:SWS:REP 35->129|KHSE_THENV|4e-04|30.5|95/100| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----1--1----------------------------1111-111-1-11-------------111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 171-174| PSIPRED ccccHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHccccHHHHHccccccccccccccEEEccccccccHHHHHHHHcccHHHcEEEEEEEEEEEcccccccccccHHHHHHHHHHccccccEEEEEEEEccccHHHHHHccccccHHHHcccccHHHHHHHHHHHHHHccc //