[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54596.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   81->134 PF06993 * DUF1304 5.5e-05 24.1 54/113  
:HMM:PFM   20->38 PF09584 * Phageshock_PspD 0.00085 57.9 19/66  
:PROS 120->151|PS00107|PROTEIN_KINASE_ATP
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54596.1 GT:GENE AAZ54596.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 634150..634611 GB:FROM 634150 GB:TO 634611 GB:DIRECTION + GB:PRODUCT putative integral membrane protein GB:PROTEIN_ID AAZ54596.1 GB:DB_XREF GI:71914694 InterPro:IPR000719 LENGTH 153 SQ:AASEQ MLRAEGPAEQGTKEAGYSEAVSRRPITLLLAAVCEGLLGVLLFILGGYVLVNTLLGNATDVNFALPLAVFAFGGSAALCYVAWGLFHLKEWARTPIVLTQLFALVIAYYLWTSDQVHLSLGLGAFAVLTLLFVLAPPTTATLFPPEGAAKKQR GT:EXON 1|1-153:0| PROS 120->151|PS00107|PROTEIN_KINASE_ATP|PDOC00100| TM:NTM 4 TM:REGION 28->50| TM:REGION 63->85| TM:REGION 91->113| TM:REGION 116->138| SEG 36->51|gllgvllfilggyvlv| SEG 120->145|lglgafavltllfvlappttatlfpp| HM:PFM:NREP 2 HM:PFM:REP 81->134|PF06993|5.5e-05|24.1|54/113|DUF1304| HM:PFM:REP 20->38|PF09584|0.00085|57.9|19/66|Phageshock_PspD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17, 147-153| PSIPRED ccccccccccccHHccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHcccccEEEEcccccccccc //