[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54610.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  76/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->127 2avnA PDBj 5e-07 30.6 %
:RPS:PDB   8->164 3cggB PDBj 2e-16 16.4 %
:RPS:SCOP  13->161 2avnA1  c.66.1.41 * 8e-22 25.7 %
:HMM:SCOP  6->237 1vl5A_ c.66.1.41 * 1.1e-36 27.4 %
:RPS:PFM   18->117 PF08241 * Methyltransf_11 9e-13 40.2 %
:HMM:PFM   18->121 PF08241 * Methyltransf_11 1.7e-23 39.1 92/95  
:BLT:SWISS 11->155 ERG6_SCHPO 8e-13 34.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54610.1 GT:GENE AAZ54610.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(652497..653228) GB:FROM 652497 GB:TO 653228 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54610.1 GB:DB_XREF GI:71914708 InterPro:IPR000051 InterPro:IPR001601 LENGTH 243 SQ:AASEQ MITIDFTLFPVGPGHRVLDLGCGGGRHAFEVYRRGADVVAFDQNAEDLAAVSAMFAAMRAEGEAPAEATAETVRGDALAMPFDDNTFDRVIAAEIMEHIPHDTAAMAEMYRVLRPGGIAVVTVPSWFPERICWALSEEYHTVEGGHIRIYTRAELEAKLKATGFIIGPHHHAHALHSPYWWLKCAVGTTNDSHPLVRAYHNLLVWDMLKAPRITRVTERLLNPLIGKSVVVYLRKPRNDGDTG GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 11->155|ERG6_SCHPO|8e-13|34.6|130/378| SEG 49->72|aavsamfaamraegeapaeataet| BL:PDB:NREP 1 BL:PDB:REP 16->127|2avnA|5e-07|30.6|98/242| RP:PDB:NREP 1 RP:PDB:REP 8->164|3cggB|2e-16|16.4|146/182| RP:PFM:NREP 1 RP:PFM:REP 18->117|PF08241|9e-13|40.2|92/96|Methyltransf_11| HM:PFM:NREP 1 HM:PFM:REP 18->121|PF08241|1.7e-23|39.1|92/95|Methyltransf_11| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 1 RP:SCP:REP 13->161|2avnA1|8e-22|25.7|136/246|c.66.1.41| HM:SCP:REP 6->237|1vl5A_|1.1e-36|27.4|223/0|c.66.1.41|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 119 OP:NHOMOORG 101 OP:PATTERN ----------------------------1--1----------------1--------1-1-------- -1-111---------11----1--11------11111-11-111-1--------------1-1----1111------------------------------111----1------------------------------33---2----1--------------------------------------------------------1-----------------------------------------------------------11-------------------------------------------------------------------------------------------1----------------------------------------------------------1-1-1---------------1-------------------------------------------------------------11-11-11----1111----11111----------------------------------------1-1-1--211-----1------------------------------------------------------1-------------------------------------------------------------------1-----1------------------------------1-----------------------------------------------------------12232--2-------1-------------------------------------------------------------------------------------------------3- -----------------------1111---------------------1111--11------1-----------------------11-1-------------111-----------------------------------------------------------------------1--------1-----------3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 97.1 SQ:SECSTR #HHHEcTHHHHcTTcEEEEETcTTcHHHHHHHHTTcEEEEEEccHHHHHHHHHHcTTcEEEEccEEEEccTTccTTTcccccccEEEEEEcccHHHccGGGHHHHHHHHHHHEEEEEEEEEEEETTEccccHHHHHHHHHHHTEEEEEEEccTTcccccTTccEEEEccccHHHHHHcGGGcTTHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHTTTEEEEEEEEEEcc###### DISOP:02AL 238-243| PSIPRED ccccHHHHHccccccEEEEEEcccHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccEEEEEEEccccccccc //