[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54625.1
DDBJ      :             ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:200 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   37->125 PF09819 * ABC_cobalt 1e-16 51.7 %
:HMM:PFM   21->144 PF09819 * ABC_cobalt 5.2e-44 49.2 124/129  
:BLT:SWISS 45->127 YKOE_BACSU 8e-14 43.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54625.1 GT:GENE AAZ54625.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 674961..675563 GB:FROM 674961 GB:TO 675563 GB:DIRECTION + GB:PRODUCT ABC transporter, permease protein GB:PROTEIN_ID AAZ54625.1 GB:DB_XREF GI:71914723 LENGTH 200 SQ:AASEQ MSPAEPQPGQDRQSLLHWRTVDIVVAAVIGVAVGIVFWVWSVLWNATTGLFAFFPPAQAILYGMWMVPGVLGGLIIRKPGAAVLTSIAAASLEMLLGTGWGVSVLISGALQGLLSELVFLAFRYRSWGMGVAVLAGVAGGISPAIRDNLTYHVTWPLSYQVVYGVLVLISAGLIAGAGSRVLTTRLAAAGALSPFASARG GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 45->127|YKOE_BACSU|8e-14|43.2|81/100| TM:NTM 5 TM:REGION 19->41| TM:REGION 51->73| TM:REGION 89->111| TM:REGION 130->152| TM:REGION 168->190| SEG 23->36|ivvaavigvavgiv| SEG 128->140|gmgvavlagvagg| SEG 186->198|laaagalspfasa| RP:PFM:NREP 1 RP:PFM:REP 37->125|PF09819|1e-16|51.7|89/129|ABC_cobalt| HM:PFM:NREP 1 HM:PFM:REP 21->144|PF09819|5.2e-44|49.2|124/129|ABC_cobalt| OP:NHOMO 56 OP:NHOMOORG 48 OP:PATTERN --1-------------1--------------------------------------------------- ---------------------1---1-------111----------1--1-1111--11111-1------11333122-----------------------------------------------------------------------------------------------------------------111--------------------1---111---1------------------------------1-11-11-111--11---111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15, 199-200| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //