[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54629.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.116.1
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   74->155 2z0kA PDBj 4e-04 31.2 %
:RPS:PDB   31->153 1dbxA PDBj 1e-15 20.2 %
:RPS:SCOP  53->153 1dbuA  d.116.1.1 * 4e-17 27.3 %
:HMM:SCOP  20->175 1dbxA_ d.116.1.1 * 2.9e-26 29.9 %
:RPS:PFM   99->153 PF04073 * YbaK 5e-07 38.2 %
:HMM:PFM   43->166 PF04073 * YbaK 3.4e-23 27.5 120/123  
:BLT:SWISS 53->153 Y1434_HAEIN 5e-06 25.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54629.1 GT:GENE AAZ54629.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 678936..679478 GB:FROM 678936 GB:TO 679478 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54629.1 GB:DB_XREF GI:71914727 LENGTH 180 SQ:AASEQ MWQLTEYPAAERTDLLAAPVAAAVTEWKHDTPVDRLRVAAIDPELADTANFCAAYGVPLDASANCVIVAARRGGETRLAACVVLATTRADINGVVRRHLGARKASFAPQEEAVQQTGMEYGGITPVGLPPEWPILIDSAVVAQPEVVVGSGLRRSKLILPGAALAELPGAEVLDGLARPA GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 53->153|Y1434_HAEIN|5e-06|25.7|101/158| SEG 157->171|lilpgaalaelpgae| BL:PDB:NREP 1 BL:PDB:REP 74->155|2z0kA|4e-04|31.2|80/156| RP:PDB:NREP 1 RP:PDB:REP 31->153|1dbxA|1e-15|20.2|119/150| RP:PFM:NREP 1 RP:PFM:REP 99->153|PF04073|5e-07|38.2|55/122|YbaK| HM:PFM:NREP 1 HM:PFM:REP 43->166|PF04073|3.4e-23|27.5|120/123|YbaK| RP:SCP:NREP 1 RP:SCP:REP 53->153|1dbuA|4e-17|27.3|99/152|d.116.1.1| HM:SCP:REP 20->175|1dbxA_|2.9e-26|29.9|154/157|d.116.1.1|1/1|YbaK/ProRS associated domain| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------111----11--11-1---------1----111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------11--------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 135 STR:RPRED 75.0 SQ:SECSTR ####################HHHHHHHHHHcHHHHHHHHHEEcccccccHHHHHHTccGGGcEEEEEEEETTcTcccETcEEEEEEETTcccHHHHHHHHTcccEEEcHHHHHHHHcccTTccccccccccccEEEEGGGGGcccEEEEcccTTE######################### DISOP:02AL 1-6| PSIPRED cccccccccccccccccccHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHcccHHHEEEEEEEEEEccccccEEEEEEEccccccHHHHHHHHHcccccccccHHHHHHHccccccccccccccccccEEEcHHHHcccEEEEEccccccEEEEcHHHHHHHHccEEEEEEcccc //