[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54636.1
DDBJ      :             similar to Uncharacterized membrane-associated protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->107 PF09335 * SNARE_assoc 7e-05 36.2 %
:HMM:PFM   11->114 PF09335 * SNARE_assoc 2.1e-16 33.0 103/123  
:HMM:PFM   78->157 PF07695 * 7TMR-DISM_7TM 8.5e-05 19.7 71/205  
:BLT:SWISS 30->116 Y2670_MYCBO 4e-05 37.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54636.1 GT:GENE AAZ54636.1 GT:PRODUCT similar to Uncharacterized membrane-associated protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 687577..688134 GB:FROM 687577 GB:TO 688134 GB:DIRECTION + GB:PRODUCT similar to Uncharacterized membrane-associated protein GB:PROTEIN_ID AAZ54636.1 GB:DB_XREF GI:71914734 LENGTH 185 SQ:AASEQ MPYEFLEGRPFWVVYLSLLGIVFARAQATYWLGRGLGAGVHRSRLGQRIGPRLEHAENLINRYGPPAVTLSFLTIGIQTAVNLTSGAMRMRFVRYLIAMFVGCLAWAAIYSLGGMAVLAAWWGLFLHSPWAATAAAAAVIAAVVGVKTWRKRRSAAALKEALAAPVADRKRATSPTLAVDREADV GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 30->116|Y2670_MYCBO|4e-05|37.2|86/218| TM:NTM 4 TM:REGION 6->28| TM:REGION 62->84| TM:REGION 98->120| TM:REGION 126->147| SEG 131->146|aataaaaaviaavvgv| SEG 155->167|aaalkealaapva| RP:PFM:NREP 1 RP:PFM:REP 11->107|PF09335|7e-05|36.2|94/119|SNARE_assoc| HM:PFM:NREP 2 HM:PFM:REP 11->114|PF09335|2.1e-16|33.0|103/123|SNARE_assoc| HM:PFM:REP 78->157|PF07695|8.5e-05|19.7|71/205|7TMR-DISM_7TM| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------11-1---1---11-----------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 184-185| PSIPRED ccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccEEccccccc //