[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54645.1
DDBJ      :             Surface protein from Gram-positive cocci, anchor region
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:414 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   119->168 3ck6C PDBj 5e-04 10.4 %
:HMM:PFM   324->347 PF07142 * DUF1388 9.1e-06 33.3 24/29  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54645.1 GT:GENE AAZ54645.1 GT:PRODUCT Surface protein from Gram-positive cocci, anchor region GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(699303..700547) GB:FROM 699303 GB:TO 700547 GB:DIRECTION - GB:PRODUCT Surface protein from Gram-positive cocci, anchor region GB:PROTEIN_ID AAZ54645.1 GB:DB_XREF GI:71914743 InterPro:IPR001899 LENGTH 414 SQ:AASEQ MLTTDSSSRTPRGVRRALVTVAGTATAAFLAFGMSAAPAFADHYSGGADAQYTGNVASGHTLSFDRGSVGTVLFQLTLSDGTKIPAYCIDFETPIRSKAKYEEGDWSEYPGEGEFANSQPGKVLWILQNSYPELSADQLSERTGIKDLTAKDALSATQAAIWHFSNGVNLKEKGTPKKVWKLYNYLIENATEIQQAPASLTISPNEASGESGGLIGEFTVSTTASSVPLTLNGPEGVQTVDLEGNPVTEVGNEDKFSVLVPEGTADGEATVSASVSATVEIGRLFKGLQGDPPTQTLITADKAETTASAEVKVTWTAPAPSDDETPGDDETPGDDETPGDDETPGDDETPTPGDDETPPATESPKPTPPADDKPGLPVTGAALGGLIAAAVVAVGGGGAAMYLARKRKSNADDA GT:EXON 1|1-414:0| SEG 14->33|vrralvtvagtataaflafg| SEG 322->370|ddetpgddetpgddetpgddetpgddetptpgddetppatespkptppa| SEG 380->400|gaalggliaaavvavggggaa| RP:PDB:NREP 1 RP:PDB:REP 119->168|3ck6C|5e-04|10.4|48/236| HM:PFM:NREP 1 HM:PFM:REP 324->347|PF07142|9.1e-06|33.3|24/29|DUF1388| OP:NHOMO 8 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------1---------------11-1112---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 48 STR:RPRED 11.6 SQ:SECSTR ######################################################################################################################cccTTEEEEETTcTTH##HHHHHHTTccHHHHHHHHcccccEEEEccTTc###################################################################################################################################################################################################################################################### DISOP:02AL 1-12, 201-217, 260-383, 404-414| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccEEEEcccEEEEEEEEEEEEcccEEEEEEEEcccccccccccccccccccccccccccccccEEEEEEEcccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccccccccHHHccccccccccEEEccccccEEEcccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccc //