[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54672.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:269 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   87->242 PF04401 * DUF540 2e-08 32.2 %
:HMM:PFM   57->241 PF04401 * DUF540 5.3e-38 33.3 180/188  
:BLT:SWISS 58->242 CYSZ_ESCF3 7e-08 24.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54672.1 GT:GENE AAZ54672.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(736770..737579) GB:FROM 736770 GB:TO 737579 GB:DIRECTION - GB:PRODUCT putative integral membrane protein GB:PROTEIN_ID AAZ54672.1 GB:DB_XREF GI:71914770 LENGTH 269 SQ:AASEQ MTLLREIFTGIGTLLRGFSMILRRPKLFFLGALPPFLTSILFVIALIALLVRLDDLTTWMTPFAADWAPGWATTVRVILGIVVVAASVLLMVIGFTTVTLALGSPLYDMIAEEVEEELGNAPKAPDEPLLRSLLRALRISLALISLSVAAAIPLFFAGFIPVVGQTVVPVLSTLVGGWLLGAELIGSAFDRRGLVRLRDRFAGLRRRRLLSLGFAVPAFLLLSIPFVAVLVFPAATAGGTILARSLLPPSLTPQAETEPSRHPNGVSRP GT:EXON 1|1-269:0| BL:SWS:NREP 1 BL:SWS:REP 58->242|CYSZ_ESCF3|7e-08|24.9|181/253| TM:NTM 6 TM:REGION 1->22| TM:REGION 33->55| TM:REGION 77->99| TM:REGION 134->156| TM:REGION 167->189| TM:REGION 217->239| SEG 41->56|lfvialiallvrlddl| SEG 129->152|llrsllralrislalislsvaaai| SEG 196->212|rlrdrfaglrrrrllsl| RP:PFM:NREP 1 RP:PFM:REP 87->242|PF04401|2e-08|32.2|152/177|DUF540| HM:PFM:NREP 1 HM:PFM:REP 57->241|PF04401|5.3e-38|33.3|180/188|DUF540| GO:PFM:NREP 3 GO:PFM GO:0009276|"GO:Gram-negative-bacterium-type cell wall"|PF04401|IPR007496| GO:PFM GO:0016021|"GO:integral to membrane"|PF04401|IPR007496| GO:PFM GO:0019344|"GO:cysteine biosynthetic process"|PF04401|IPR007496| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------1-----------11--1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 115-123, 251-269| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccccccccccccccc //