[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54694.1
DDBJ      :             ABC Fe3+-hydroxamate transporter substrate-binding protein
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  262/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:308 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   58->302 2r7aB PDBj 3e-14 24.6 %
:RPS:PDB   39->303 3eiwA PDBj 8e-39 18.6 %
:RPS:SCOP  32->305 2chuA1  c.92.2.4 * 5e-42 17.2 %
:HMM:SCOP  30->302 2chuA1 c.92.2.4 * 3.7e-57 33.3 %
:RPS:PFM   59->281 PF01497 * Peripla_BP_2 4e-16 35.9 %
:HMM:PFM   59->281 PF01497 * Peripla_BP_2 3.2e-40 33.5 221/238  
:BLT:SWISS 21->302 YVRC_BACSU 3e-30 30.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54694.1 GT:GENE AAZ54694.1 GT:PRODUCT ABC Fe3+-hydroxamate transporter substrate-binding protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 760700..761626 GB:FROM 760700 GB:TO 761626 GB:DIRECTION + GB:PRODUCT ABC Fe3+-hydroxamate transporter substrate-binding protein GB:PROTEIN_ID AAZ54694.1 GB:DB_XREF GI:71914792 LENGTH 308 SQ:AASEQ MRVARRFTALSLPLLLALAACGSPAEEPAADQSSSTGEFPVTVADARGDVTIEEKPTRIISLSPSLTEILFEVGAGDQVVAVDEYSNYPPEAPTTDLSGFTPNVEAIADYEPDLVVLSDDSSDITEQLEKLHIPVLLLPAAEKLEDTFAQMELLGEATGNADEGIDAAEELRERMDAIVAEVVDDGAAGLSYYHEIDAQLYSVTSDTFIGQIYDLFGLVNIADEAEDPAGGYPQLSAEFIVEQDPDLIFVSYPGGVDDVLGRPAFATVTAVQQKNVVEVDADISSRWGPRVADFVEEVAEAIETARSE GT:EXON 1|1-308:0| BL:SWS:NREP 1 BL:SWS:REP 21->302|YVRC_BACSU|3e-30|30.6|278/314| SEG 9->20|alslplllalaa| SEG 113->123|dlvvlsddssd| BL:PDB:NREP 1 BL:PDB:REP 58->302|2r7aB|3e-14|24.6|240/256| RP:PDB:NREP 1 RP:PDB:REP 39->303|3eiwA|8e-39|18.6|263/292| RP:PFM:NREP 1 RP:PFM:REP 59->281|PF01497|4e-16|35.9|217/235|Peripla_BP_2| HM:PFM:NREP 1 HM:PFM:REP 59->281|PF01497|3.2e-40|33.5|221/238|Peripla_BP_2| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 32->305|2chuA1|5e-42|17.2|267/283|c.92.2.4| HM:SCP:REP 30->302|2chuA1|3.7e-57|33.3|270/0|c.92.2.4|1/1|"Helical backbone" metal receptor| OP:NHOMO 317 OP:NHOMOORG 286 OP:PATTERN 11---11-----------------1111111------------1-212-1----1111121------- ----1--1111--------------------------211-----2--2-----------11-1111-121-----------1------------------------------------------11111-111-1111--2131--------------------------------------2322211--11---------------121111---1112---111111311--------------111111----------------------------------------------------------------------12-1111111111-1---1111111--2---211----111-211-----1-----11111------------1----------1---------111-1---1-------1----11-----1-----------------------------------------------------1-----------11111111111111--11111--11112111211111111---1-1---------11-1-121-1----1-------1---1-------121-11-11-1-----------1------111111--11-111111111111111112----11-1------2-1-----111-111---1---111-1-111---------1111--------------------1-------11111111111--------------1--1---------------------1----1--------------------------1---11111111111------------------11------------1----------------------------111-111-1--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 275 STR:RPRED 89.3 SQ:SECSTR ###############################cEEEEcccEEEEEETTEEEEEETTcccEEEccHHHHHHHHHTTccccEEccTTcGGHHHHHcccEEccccccHHHHHHTcccEEEEETTTTTTHHHHHHHccEEEEccTTccHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHccccTTccEEEEEEETTEEEEccTTcHHHHHHHHTTccccccHGGGEETTEEEEcHHHHHHHcccEEEEEccHHHHHHHHcHHHHTcHHHHTTcEEEEEHHHHTTTccHHHHHHHHHHHHHHccc## DISOP:02AL 1-3, 22-39, 307-308| PSIPRED ccHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEcccEEEEcccccEEEEEccHHHHHHHHHcccccEEEcccHHHcHHHHcccccccccccHHHHHHccccEEEEccccHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEcccccHHHHHHHHcccccHHHHcccccccccccHHHHHHHcccEEEEEccccHHHHHccHHHHcccHHHcccEEEEccHHHHcccHHHHHHHHHHHHHHHHHHcc //