[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54704.1
DDBJ      :             LSU ribosomal protein L19P
Swiss-Prot:RL19_THEFY   RecName: Full=50S ribosomal protein L19;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:114 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->113 1vs9N PDBj 2e-34 57.8 %
:RPS:PDB   5->111 3bboR PDBj 6e-32 40.6 %
:RPS:SCOP  5->114 2j01T1  b.34.5.6 * 1e-39 57.3 %
:HMM:SCOP  2->115 2gyaN1 b.34.5.6 * 3.2e-42 64.0 %
:RPS:PFM   5->113 PF01245 * Ribosomal_L19 3e-33 68.8 %
:HMM:PFM   3->114 PF01245 * Ribosomal_L19 3.1e-52 62.5 112/113  
:BLT:SWISS 1->114 RL19_THEFY 3e-61 100.0 %
:PROS 86->101|PS01015|RIBOSOMAL_L19

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54704.1 GT:GENE AAZ54704.1 GT:PRODUCT LSU ribosomal protein L19P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 771668..772012 GB:FROM 771668 GB:TO 772012 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L19P GB:PROTEIN_ID AAZ54704.1 GB:DB_XREF GI:71914802 InterPro:IPR001857 LENGTH 114 SQ:AASEQ MHTAIQELEKAQLRSDVPDFRPGDTLNVHVRVTEGNRTRIQVFKGVVIRRQGSGIRETFTVRKISYAVGVERTFPVHSPVIEKIEVVSRGRVRRAKLYYLRNLRGKAARIRERR GT:EXON 1|1-114:0| SW:ID RL19_THEFY SW:DE RecName: Full=50S ribosomal protein L19; SW:GN Name=rplS; OrderedLocusNames=Tfu_0666; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->114|RL19_THEFY|3e-61|100.0|114/114| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 86->101|PS01015|RIBOSOMAL_L19|PDOC00778| BL:PDB:NREP 1 BL:PDB:REP 5->113|1vs9N|2e-34|57.8|109/114| RP:PDB:NREP 1 RP:PDB:REP 5->111|3bboR|6e-32|40.6|106/113| RP:PFM:NREP 1 RP:PFM:REP 5->113|PF01245|3e-33|68.8|109/112|Ribosomal_L19| HM:PFM:NREP 1 HM:PFM:REP 3->114|PF01245|3.1e-52|62.5|112/113|Ribosomal_L19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01245|IPR001857| GO:PFM GO:0005622|"GO:intracellular"|PF01245|IPR001857| GO:PFM GO:0005840|"GO:ribosome"|PF01245|IPR001857| GO:PFM GO:0006412|"GO:translation"|PF01245|IPR001857| RP:SCP:NREP 1 RP:SCP:REP 5->114|2j01T1|1e-39|57.3|110/137|b.34.5.6| HM:SCP:REP 2->115|2gyaN1|3.2e-42|64.0|114/0|b.34.5.6|1/1|Translation proteins SH3-like domain| OP:NHOMO 964 OP:NHOMOORG 929 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111111111111111111111111 --------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------1112G122113253-52--1-111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 96.5 SQ:SECSTR ####TTHHHHTTccccccccccccccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccccccccccccccccccccccccccTTcccccccc DISOP:02AL 113-114| PSIPRED cHHHHHHHHHHHHHccccccccccEEEEEEEEEccccEEEEEEEEEEEEEcccccccEEEEEEEEccccEEEEEcccccEEEEEEEEEEccEEHHHHHEEccccccEEEEEEcc //