[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54717.1
DDBJ      :             ribosome recycling factor
Swiss-Prot:RRF_THEFY    RecName: Full=Ribosome-recycling factor;         Short=RRF;AltName: Full=Ribosome-releasing factor;

Homologs  Archaea  0/68 : Bacteria  906/915 : Eukaryota  72/199 : Viruses  0/175   --->[See Alignment]
d.67.3
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->172 1wqgA PDBj 7e-48 55.9 %
:RPS:PDB   19->172 1dd5A PDBj 7e-54 43.5 %
:RPS:SCOP  19->172 1dd5A  d.67.3.1 * 3e-54 43.5 %
:HMM:SCOP  1->185 1ek8A_ d.67.3.1 * 1e-63 57.3 %
:RPS:PFM   21->172 PF01765 * RRF 3e-36 53.9 %
:HMM:PFM   20->183 PF01765 * RRF 1e-63 51.8 164/165  
:BLT:SWISS 17->172 RRF_THEFY 1e-85 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54717.1 GT:GENE AAZ54717.1 GT:PRODUCT ribosome recycling factor GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 782961..783518 GB:FROM 782961 GB:TO 783518 GB:DIRECTION + GB:PRODUCT ribosome recycling factor GB:PROTEIN_ID AAZ54717.1 GB:DB_XREF GI:71914815 InterPro:IPR002661 LENGTH 185 SQ:AASEQ MIEETLLEAEEKMEKAVLVTKEDFASIRTGRPSPATFSRITVEYYGAMTPVNQLASFQVPEPRMVIISPYDKAAMPAIEKAIRESDLGVNPSNDGNIIRVVFPELSEERRKEYVKVARNKAEDGRTSVRNVRRQAKDAIDKAVKAGEIGEDEGHRAQKELDALTQKYVGEIDELLKHKESELLEV GT:EXON 1|1-185:0| SW:ID RRF_THEFY SW:DE RecName: Full=Ribosome-recycling factor; Short=RRF;AltName: Full=Ribosome-releasing factor; SW:GN Name=frr; OrderedLocusNames=Tfu_0679; SW:KW Complete proteome; Cytoplasm; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 17->172|RRF_THEFY|1e-85|100.0|156/185| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| SEG 3->16|eetlleaeekmeka| SEG 173->184|ellkhkeselle| BL:PDB:NREP 1 BL:PDB:REP 21->172|1wqgA|7e-48|55.9|152/184| RP:PDB:NREP 1 RP:PDB:REP 19->172|1dd5A|7e-54|43.5|154/184| RP:PFM:NREP 1 RP:PFM:REP 21->172|PF01765|3e-36|53.9|152/165|RRF| HM:PFM:NREP 1 HM:PFM:REP 20->183|PF01765|1e-63|51.8|164/165|RRF| GO:PFM:NREP 1 GO:PFM GO:0006412|"GO:translation"|PF01765|IPR002661| RP:SCP:NREP 1 RP:SCP:REP 19->172|1dd5A|3e-54|43.5|154/184|d.67.3.1| HM:SCP:REP 1->185|1ek8A_|1e-63|57.3|185/185|d.67.3.1|1/1|Ribosome recycling factor, RRF| OP:NHOMO 1017 OP:NHOMOORG 978 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----111-----111-------------------------------------------------------------------------------------111111-141211--111-1-11111-1-541-121-1111-111-1---1--1111-1----------1-----21229222212222-214221111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 83.2 SQ:SECSTR ##################HHHHHHHHcccccccGGGGTTcEEEETTEEEEGGGcEEEEEccTTEEEEEEccTTHHHHHHHHHHHcccccccEEccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHH############# DISOP:02AL 185-186| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccEEEEEcccEEEHHHEEEEEcccccEEEEEEccHHHHHHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //