[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54743.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->71 PF06720 * Phi-29_GP16_7 0.00064 29.8 57/130  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54743.1 GT:GENE AAZ54743.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(817403..817765) GB:FROM 817403 GB:TO 817765 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54743.1 GB:DB_XREF GI:71914841 LENGTH 120 SQ:AASEQ MKSSPMSEIGHFPLTEQTSDRTAHLSRLADAIRSLGVTALIALSATSHPVLYVRTRTRLVPVVVVEDLVGNQWFIWGRTGTAHVSQVNHAAAALCGLDRAVTRSRVNPVAARRAALREAA GT:EXON 1|1-120:0| SEG 49->65|pvlyvrtrtrlvpvvvv| SEG 110->119|aarraalrea| HM:PFM:NREP 1 HM:PFM:REP 15->71|PF06720|0.00064|29.8|57/130|Phi-29_GP16_7| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 117-120| PSIPRED cccccccHHcccccccccccHHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEcccEEEEEEEEEcccccEEEEEEcccHHHHccHHHHHHHHHcccccccccccccHHHHHccccccc //