[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54761.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   105->140 PF05901 * Excalibur 3e-08 61.1 %
:HMM:PFM   104->140 PF05901 * Excalibur 2.6e-15 35.1 37/37  
:HMM:PFM   37->78 PF06280 * DUF1034 3.3e-05 19.0 42/112  
:PROS 1->61|PS00430|TONB_DEPENDENT_REC_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54761.1 GT:GENE AAZ54761.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 846032..846460 GB:FROM 846032 GB:TO 846460 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54761.1 GB:DB_XREF GI:71914859 InterPro:IPR010916 LENGTH 142 SQ:AASEQ MTLQDRGSSVNEKVGCAAAGLVFLVIVASCFPSKEDKGEPWAEPTPTVTVTATETVEVEATETVEVEVTVTATETVQETVSSGSGSTNREPAPPAPQPAPAAEYYENCAAARAAGATPIYEGQPGYGRHLDRDGDGVGCEWG GT:EXON 1|1-142:0| PROS 1->61|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| TM:NTM 1 TM:REGION 10->31| SEG 42->80|aeptptvtvtatetveveatetvevevtvtatetvqetv| SEG 91->102|pappapqpapaa| RP:PFM:NREP 1 RP:PFM:REP 105->140|PF05901|3e-08|61.1|36/37|Excalibur| HM:PFM:NREP 2 HM:PFM:REP 104->140|PF05901|2.6e-15|35.1|37/37|Excalibur| HM:PFM:REP 37->78|PF06280|3.3e-05|19.0|42/112|DUF1034| OP:NHOMO 32 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- -----1-------------------1-----------212--------------1--------------111--------------------------------------------------------------------------------------------------------------------------11111-11-111111------1---------------1----------------------------------------------------------------------------------11---111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 76-102| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEEEEEEEEEEEEEEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccHHcccccccccccccc //