[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54765.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.1.1
:197 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->195 2vebA PDBj 6e-64 58.0 %
:HMM:SCOP  3->189 1or4A_ a.1.1.2 * 1.4e-16 18.9 %
:RPS:PFM   19->191 PF11563 * Protoglobin 8e-62 59.5 %
:HMM:PFM   3->197 PF11563 * Protoglobin 3.1e-112 68.2 195/196  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54765.1 GT:GENE AAZ54765.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(854999..855592) GB:FROM 854999 GB:TO 855592 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54765.1 GB:DB_XREF GI:71914863 LENGTH 197 SQ:AASEQ MATKTLIPGYTYGTEQVAKSPIGLEDLNKLKTTVMFTSADEEALRMAGDVLEDQVEDVLDVWYGFVADHPHLLAYFSTPDGHPIQEYLDRVRERFGQWILDTCRRPYNQEWLDYQQEIALRHTPEKKNVTDNANSVDNIPLRYVIAFIYPVTATLRPFLAKKGHSADQVEAMYQAWFKSVTMQIALWSQPYTRDGYW GT:EXON 1|1-197:0| SEG 49->61|dvledqvedvldv| BL:PDB:NREP 1 BL:PDB:REP 7->195|2vebA|6e-64|58.0|188/190| RP:PFM:NREP 1 RP:PFM:REP 19->191|PF11563|8e-62|59.5|173/180|Protoglobin| HM:PFM:NREP 1 HM:PFM:REP 3->197|PF11563|3.1e-112|68.2|195/196|Protoglobin| HM:SCP:REP 3->189|1or4A_|1.4e-16|18.9|169/169|a.1.1.2|1/1|Globin-like| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN 11-----------------1------------------------------11---------------- -----------------------------------------------------------------11---1-----------1-----------------------------------------------------111-1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 95.4 SQ:SECSTR ######cTTccTT#cccccccccHHHHHHHHHHHTccHHHHHHHHHHHHHHGGGHHHHHHHHHHHHHTcHHHHGGGccTTccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcTTTTTTTTTccccccccHHHHHHTHHHHHHTTHHHHTcccccHHHHHHHHHHHHHHHHHHHHHHTGGGccTT## DISOP:02AL 1-3, 127-130| PSIPRED cccccccccccccHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccc //