Thermobifida fusca YX (tfus0)
Gene : AAZ54770.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54770.1 GT:GENE AAZ54770.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 862376..862639 GB:FROM 862376 GB:TO 862639 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54770.1 GB:DB_XREF GI:71914868 LENGTH 87 SQ:AASEQ MCGKGFPYRYVLIAQSFRACHPTGSTPPKPHFGGGPVRSAARRRLGQCALVVAATAAPLLSTLTVGTASAHGPTINPLSRPYSCWEQ GT:EXON 1|1-87:0| SEG 49->65|alvvaataapllstltv| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccEEEEEEEcHHHHcccccccccccccccccccHHHHHHHccEEEEEEccccHHHHHHHccccccccccccccccccccccc //