[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54774.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.10.1
:342 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   100->319 2ra8A PDBj 2e-22 32.2 %
:RPS:SCOP  198->299 1pgvA  c.10.1.1 * 8e-07 16.3 %
:HMM:SCOP  104->325 1fqvA2 c.10.1.3 * 0.0002 29.4 %
:BLT:SWISS 240->314 BRU1_ARATH 4e-04 37.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54774.1 GT:GENE AAZ54774.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 864720..865748 GB:FROM 864720 GB:TO 865748 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54774.1 GB:DB_XREF GI:71914872 LENGTH 342 SQ:AASEQ MSFYEHLTDFAGLPVVEFLSPAIEQQKLLDAQWRARRAEQPVPDRWEPGDIYAEALAQPGTAAWRLRVVADSDETFEDHFTRFISSVDTTQVTALIIGCWGESYEIAGDMPRDLLTAHADRFPALRSLFFGEFIVEEAEISWIEQTDLAPLLAAFPGMEELVVRGGNGLRLSATQHRSLRKLTAQTGGLPRQATAGILASELPALEHLELWFGVEGYGGTTTLDDLTPLLAGELFPSLRSLGLRNSEWGDDLVRALAEAPVLERVRVLNLSDHVLTDAGGEVLATAPTFRTLERLVIRHHFLTEGMQERVRAALAGVDLELSDARKPEVYQGKTYYYPSVTE GT:EXON 1|1-342:0| BL:SWS:NREP 1 BL:SWS:REP 240->314|BRU1_ARATH|4e-04|37.3|75/1311| SEG 220->230|tttlddltpll| BL:PDB:NREP 1 BL:PDB:REP 100->319|2ra8A|2e-22|32.2|214/339| RP:SCP:NREP 1 RP:SCP:REP 198->299|1pgvA|8e-07|16.3|98/167|c.10.1.1| HM:SCP:REP 104->325|1fqvA2|0.0002|29.4|201/286|c.10.1.3|1/1|RNI-like| OP:NHOMO 30 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ----3----------------------------------------------------------------21-----------------11------------------------------------------------------4----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------------------------------------------------------------------------------------------------------1----------11111--1111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 62.6 SQ:SECSTR ###################################################################################################ccccccccHHHH#HHHHTTHHHHTTccEEEEccccTTTccGGGccccccHHHHHT#TTccEEEEEcccTccccccccTTccEEEEEcccccHHHHHHHHHcccTTccEEEEEcccGGG#TccccGGTGGGccTTTcTTccEEEEEccTTHHHHHHHH#HcccGGGccE#EcccccccHHHHHHHHTTHHHHTTccEEEccccccHHHHH#HHHHccEEEc####################### DISOP:02AL 1-3| PSIPRED ccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHcccccEEEEEEEEccHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHccccccHHHHHHccHHHHHHHHHHHHccccHHHEEEEEEEccHHHHHHHccccEEEEEEcccccEEccccccccEEEEEEEccccHHHHHHHHHcccccccEEEEEEEEccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHcccccccEEEEEEEEccccHHHHHHHHHHHcccccccccccccccccccEEccccccc //