[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54778.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:302 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  18->173 1tv7A  c.1.28.3 * 1e-04 15.6 %
:HMM:SCOP  7->246 1tv8A_ c.1.28.3 * 3.7e-13 22.3 %
:HMM:PFM   16->113 PF04055 * Radical_SAM 0.00013 22.0 91/166  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54778.1 GT:GENE AAZ54778.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 869757..870665 GB:FROM 869757 GB:TO 870665 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54778.1 GB:DB_XREF GI:71914876 LENGTH 302 SQ:AASEQ MTLPHDITILYRGPLASCDYDCSYCPFAKRRDTPEQLRADRAAVERFVDWVASQATQSPGKRISVLFTPWGEGLVRSWYRAAMVRLSHLPHVERVAIQTNLSCRVEWLAECDRETAALWATFHPSQTRYERFLAKCFRLRELGVRFSVGIVGLPEHLAAACRLRADLPDDVYLWVNAVGGRSYTDAEAAPWQEIDPLFPYSRDPHPSRGRLCRTGNTVVSVFGDGTVRRCHFLPTELGNLYDGSFVARLRPRPCPAASCDCHIGYVHLESLDLYDVFRGGVLERIPAGWGRGELSPQSSRCR GT:EXON 1|1-302:0| HM:PFM:NREP 1 HM:PFM:REP 16->113|PF04055|0.00013|22.0|91/166|Radical_SAM| RP:SCP:NREP 1 RP:SCP:REP 18->173|1tv7A|1e-04|15.6|154/327|c.1.28.3| HM:SCP:REP 7->246|1tv8A_|3.7e-13|22.3|233/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------------------------------------------11-----------------11------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1----------11111--1111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 296-302| PSIPRED ccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHcEEEEEEccccEEcHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEEcHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHccccccccccccccccccccccEEEEEccccEEEEccccccEEccEEcccccccccccccccccccEEEEEEEEccHHHHHHHHccHHHHcccccccccccccccccc //