[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54783.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.47.1
:361 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   152->358 3cp7A PDBj 1e-27 31.5 %
:RPS:PDB   163->319 3cp7A PDBj 2e-08 33.1 %
:RPS:SCOP  147->315 1p3cA  b.47.1.1 * 1e-22 25.0 %
:HMM:SCOP  154->349 1agjA_ b.47.1.1 * 7.3e-19 19.4 %
:HMM:PFM   162->326 PF00089 * Trypsin 2.5e-09 20.1 149/219  
:HMM:PFM   35->95 PF10738 * Lpp-LpqN 0.00016 25.0 52/241  
:BLT:SWISS 163->239 MPR_BACSU 2e-09 35.1 %
:PROS 179->184|PS00134|TRYPSIN_HIS
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54783.1 GT:GENE AAZ54783.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(877183..878268) GB:FROM 877183 GB:TO 878268 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54783.1 GB:DB_XREF GI:71914881 InterPro:IPR001254 LENGTH 361 SQ:AASEQ MPFPRFVPAQPAKITKRSHLNTESVACFGDMNRSIMYAFLASLTLVAAGIAPASAVEPSHPVPLDPAPEVVHQSAATTPEQQRAVAAYWTPDRMAAALPLPSALDDLPVSLSLLGGRRASDTDTDTDTDTTSLSDSSVRRWTGGGLVAATTGRVYLTLDGVDYTCTASVINAQNRDTVLTAGHCLKNKTGSWAENWIFVPGYADGRAPYGRYTARDMLVSPKWSRQGDDSYDFGFVVLNTDLRGRHVADRTGAQKVSFSGRIAPYVHAFGYPSSPPYSGRHLYYCAGATHADRQGTLGSGMDCAMTQGSSGGPWFADFDTTTGTGTITSLTSFKYTDNAAVQYGPRLGDEARRVYEAAQIL GT:EXON 1|1-361:0| BL:SWS:NREP 1 BL:SWS:REP 163->239|MPR_BACSU|2e-09|35.1|74/313| PROS 179->184|PS00134|TRYPSIN_HIS|PDOC00124| TM:NTM 1 TM:REGION 34->56| SEG 95->114|aaalplpsalddlpvslsll| SEG 120->137|sdtdtdtdtdttslsdss| SEG 320->332|tttgtgtitslts| BL:PDB:NREP 1 BL:PDB:REP 152->358|3cp7A|1e-27|31.5|203/216| RP:PDB:NREP 1 RP:PDB:REP 163->319|3cp7A|2e-08|33.1|157/216| HM:PFM:NREP 2 HM:PFM:REP 162->326|PF00089|2.5e-09|20.1|149/219|Trypsin| HM:PFM:REP 35->95|PF10738|0.00016|25.0|52/241|Lpp-LpqN| RP:SCP:NREP 1 RP:SCP:REP 147->315|1p3cA|1e-22|25.0|160/215|b.47.1.1| HM:SCP:REP 154->349|1agjA_|7.3e-19|19.4|180/242|b.47.1.1|1/1|Trypsin-like serine proteases| OP:NHOMO 61 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- ----3---------------------------------1--1111----843121-----1---11-3211-------------------------------------------------------------------------1---------------------1--------------------------------11---11--1-------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------------------------------------1------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----2312----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 58.7 SQ:SECSTR ##################################################################################################################################################cTTGGEEEEEEETTEEEEEEEEEcccTTccEEEEcGGGTcccTTccccEEEEEETccccccTTccEEEEEEEEcHHHHHHccGGGccEEEEEcccTTccHHHHHccccccccccccccEEEEEEccccTTccccccEEEEEEcEEcTTccccEEEEccccTTcTTcEEEEccccccccccEEEEccEEETTEEEEEEEccccHHHHHHHHHH### DISOP:02AL 1-2, 60-61, 78-81, 115-131| PSIPRED cccccccccccHHHHHHHccccccEEEEccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHcccccHHHHHHHHcccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccEEEEEEccccEEEEEEEEccccccEEEEEEEEEEcccccEEEEEEEEEEccccccccEEEEEEEEEEcccHHccccccccEEEEEEEcccccccccccccccccccccccccEEEEEEEcccccccccEEEEEEccEEcccccEEEEEEccccccccccccEEEEccccccccEEEEEEEEcccccccccccccccHHHHHHHHHHHcc //