[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54792.1
DDBJ      :             putative ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:324 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->52 2ofwG PDBj 6e-05 42.0 %
:RPS:PDB   1->284 1cp2A PDBj 2e-08 12.7 %
:RPS:SCOP  3->59 1f48A1  c.37.1.10 * 2e-09 31.6 %
:HMM:SCOP  1->240 1f48A2 c.37.1.10 * 3.9e-22 23.9 %
:RPS:PFM   7->47 PF01656 * CbiA 6e-04 48.8 %
:HMM:PFM   7->213 PF01656 * CbiA 1.8e-13 27.6 127/194  
:BLT:SWISS 1->223 COOC_RHORU 3e-20 34.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54792.1 GT:GENE AAZ54792.1 GT:PRODUCT putative ATP-binding protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(890812..891786) GB:FROM 890812 GB:TO 891786 GB:DIRECTION - GB:PRODUCT putative ATP-binding protein GB:PROTEIN_ID AAZ54792.1 GB:DB_XREF GI:71914890 LENGTH 324 SQ:AASEQ MKIAFVGKGGSGKTTLSALFSRYLAHCGVPVVAIDADINQHLGTALGASPAELSTIPPLGSHLTDLKEILRGRNPRIASAEQMVKTTPPGRGSRLLDLSADNPVHQRFGRDIGGVLLMLTGPFSEDDLGVSCYHSKVGAVEMYLNHLVDGPGEYVVVDMTAGADSFASGLFTRFDVTFLVAEPTVRGVGVYRQYVDYARDYDVTVHVIGNKVHGPDDVEFLRDHVGDALTVCLTHSGFVRAMEKGRFLDLAELEEDNLKALARMRDLVDAAEQDWEKFTRQTVEFHLRNAEKWANAATGVDLAAQVDPEFTMGPEALAASRQWC GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 1->223|COOC_RHORU|3e-20|34.0|206/263| BL:PDB:NREP 1 BL:PDB:REP 3->52|2ofwG|6e-05|42.0|50/201| RP:PDB:NREP 1 RP:PDB:REP 1->284|1cp2A|2e-08|12.7|244/269| RP:PFM:NREP 1 RP:PFM:REP 7->47|PF01656|6e-04|48.8|41/178|CbiA| HM:PFM:NREP 1 HM:PFM:REP 7->213|PF01656|1.8e-13|27.6|127/194|CbiA| RP:SCP:NREP 1 RP:SCP:REP 3->59|1f48A1|2e-09|31.6|57/296|c.37.1.10| HM:SCP:REP 1->240|1f48A2|3.9e-22|23.9|201/278|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 44 OP:NHOMOORG 37 OP:PATTERN ----------------------------------111---1--11--3--1------1---------- ----1--------------------------------------2-----------------1-----1111------------------------------------------------------1---11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------1---------------222------11--1-------------------------1---------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1-1--1-1-1----1---------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 318 STR:RPRED 98.1 SQ:SECSTR cEEEEEEcTTccHHHHHHHHHHHHHTTTccEEEEEEcTTccTTHHHHTccccccHHHHHHHHHcccHHHHTccccccHHHHHHHHGGGcEEcGGGccHHHHcEEcGGGcEEEEccccEEEcccccTTcccHHHHHHHHHHHHHHTTcccTTccEEEEEEEcccccTTTTHHHHTcEEEEEEcccHHHHHHHHHHHHHHHHHcTTcccEEEEEEEEccHHHHHHHHTccEEEEEcccHHHHHHHTTccHHHHcTTcHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHTccGGGGGc#####cccccccccccTT# PSIPRED cEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEcccccccHHHccccccccccccHHHHHHHHHHHHHHHcccccccHHccHHccccccccHHHccccccccHHHcccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHccccEEEEccccHHHHHHHcccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccEEcHHHHHHHHccc //